GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:35:04

Sequence FGF21_1 : 4383 bp : 58.22% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1305   1435  131  0  2   38   87   139 0.717  10.32
aatctggcaccaattctaaaccactcagcttctccgagctcacaccccggagatcacctg
aggacccgagccattgatggactcggacgagaccgggttcgagcactcaggactgtgggt
ttctgtgctggctggtcttctgctgggagcctgccaggcacaccccatccctgactccag
TCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGGTACCTCTACACAGATGATGCCCA
GCAGACAGAAGCCCACCTGGAGATCAGGGAGGATGGGACGGTGGGGGGCGCTGCTGACCA
GAGCCCCGAAA
gtgagtgtgggccagagcctgggtctgagggaggaggggctgtgggtctggattcctggg
tctgagggaggaggggctgggggccttggcccctgggtctgagggaggaggggctgggga
tctggactcctgggtctgagggaggaggggctggggatctgggcccctgggtctgaggga

 1.02 Intr +   1890   1993  104  1  2   77  109   100 0.999  12.06
cttgggtctgagttgggagggggctttggcttgggcttctcctgggtctgagggaggagg
taggctgtgggcttggactcccagggctgggacagagccggatggtgggacagagtcggg
tggtgggacagtcccgggtgggagaggtcctcgaaccaccttatcgctttcaccccttag
GTCTCCTGCAGCTGAAAGCCTTGAAGCCGGGAGTTATTCAAATCTTGGGAGTCAAGACAT
CCAGGTTCCTGTGCCAGCGGCCAGATGGGGCCCTGTATGGATCG
gtgagtttccaggaccctcctcaccacccaccatgctcctcctatatgtcgccctcacag
cctggggtgccttgtcttgctcatcccccccggagccagacttgattctatttgctctgc
acgcccccagctgcaacatttggaggttgaagttgtcatcagtgtttgcaagatgaggaa

 1.03 Term +   2894   3184  291  1  0  111   48   289 0.946  23.56
gggcctggactcctgggtcggatggaggagaaactagggtctggacccctgggtctgagg
gaggaggcgctgggggcctggacccctgggtctgagggaggcagggctggggcctggatc
ctgggtcttacatcaggaaaacagaggaaccctgtctctgatcctgtttttgtcccctag
CTCCACTTTGACCCTGAGGCCTGCAGCTTCCGGGAGCTGCTTCTTGAGGACGGATACAAT
GTTTACCAGTCCGAAGCCCACGGCCTCCCGCTGCACCTGCCAGGGAACAAGTCCCCACAC
CGGGACCCTGCACCCCGAGGACCAGCTCGCTTCCTGCCACTACCAGGCCTGCCCCCCGCA
CTCCCGGAGCCACCCGGAATCCTGGCCCCCCAGCCCCCCGATGTGGGCTCCTCGGACCCT
CTGAGCATGGTGGGACCTTCCCAGGGCCGAAGCCCCAGCTACGCTTCCTGA
agccagaggctgtttactatgacatctcctctttatttattaggttatttatcttattta
tttttttatttttcttacttgagataataaagagttccagaggaggataagaatgagcat
gtgtgagtgtctgagggaagacatggcagctgttttgtctcccttggcccggacaatccc

Predicted peptide sequence(s):


>FGF21_1|GENSCAN_predicted_peptide_1|175_aa
XPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQIL
GVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHR
DPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS