GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:18:49

Sequence EFNA2_1 : 16176 bp : 64.35% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1340  140  0  2  112   99   482 0.999  49.44
tctcggcgcccgaggtcgcgcgcgcggaggcgggggcggcccgggatctccaagcgccgc
cgcgccctcctcccgcccgccctccgcccgcccgctcggcggcggcggcggcggcggagg
aggcggagaaggctggcaggcggcggccgggagagcgagcgcggcggccggaccggggcc
ATGGCGCCCGCGCAGCGCCCGCTGCTCCCGCTGCTGCTCCTGCTGTTACCGCTGCCGCCG
CCGCCCTTCGCGCGCGCCGAGGACGCCGCCCGCGCCAACTCGGACCGCTACGCCGTCTAC
TGGAACCGCAGCAACCCCAG
gtgagcgcggccgcgcgcggggggcgcccggggaccccccaacgccccccaagccgcgcc
cggcctcgcgcccccggagctccgggcgccccccacgcgcgcgccgccgccgggatgcgg
gcgcccggttcccgcgggagccccccagggagctccggccccccggagtttgggggactc

 1.02 Term +   1815   1914  100  0  1  114   55    34 0.993   1.22
gtaccctccgatgccgggtagcccctgagttgcctgcctggacttggggggacccctgat
ccacccgcttctctggggagccccctcggtttcgcatttggtggggatccccggggacct
tggcaccggaggtgggggactgtggccctcgagggatctctgggttcgtcctgcccgcag
GTCCCCAGATGAACTTGGGGAAGTTGGAGTGTCCCTCCCTCAGGACCCAGCATCTGCTTC
ACTCCAGGGGGCCAAGGGCCCAGCTTTGAAAGGAGACTGA
ggggccggggagctgggggtcagccccgggaggggcagtgggatggagtcctctcttgtc
ctctgggcgctgaccaggaaactgaggtgcagaggggatgaggagctggctcaaggtcat
gcaagggggggacttgggggcaggacccaggtggcccagtgccctgcctgccacgcccgg

 2.06 PlyA -   2774   2769    6                              -4.82
 2.05 Term -   3402   2839  564  0  0   90   47   116 0.048   3.25
 2.04 Intr -   4149   3995  155  1  2   58   94    62 0.787   4.78
 2.03 Intr -   5002   4616  387  2  0   78   81   124 0.769   6.77
 2.02 Intr -   6181   6107   75  2  0  115   92    24 0.557   6.14
 2.01 Init -   6467   6335  133  2  1   63   59    45 0.444  -0.47
 2.00 Prom -   7746   7707   40                              -4.16

 3.01 Init +   8707   8753   47  0  2   75   91     6 0.828  -0.95
gaaagggagcctctgagaggaggccggacctcgagacccaagggttcaaatccagacgca
agcccagaactgcaagattccgaagccccggaagggcccctgccctccaggcctggtgcc
cgggggagatttccctgcaacacgccctcccatgtcccctgtgctgggctcacaggggtg
ATGAAGGAGGCCTGGGAAGCTCTCTGTCCCTGGACGAATCCAACCAG
gtagggaagggctggagggtgacttcaccgcctccgccgccctgccttgaaattctttgc
tctggagatcttcatgccggatccctagtggggaaactgaggcgcaagtgagcacacctg
tctgccccttctcacccctggagacccaggaacccccggccccgcctggcgtggcatctc

 3.02 Intr +  10577  10890  314  2  2  145   65   728 0.936  73.30
tgaccctgtcccccctggcgcaccctgacccgtcccccgtgctcctgaccccggccctcg
ccgcgcaccccgacccgtccctcgtgctcctgtcccctgaccctggccctccccgcgcac
cccgacccgtgccccgttcctcgctccgggcgctgacctctggccgccttgtccccgcag
GTTCCACGCAGGCGCGGGGGACGACGGCGGGGGCTACACGGTGGAGGTGAGCATCAATGA
CTACCTGGACATCTACTGCCCGCACTATGGGGCGCCGCTGCCGCCGGCCGAGCGCATGGA
GCACTACGTGCTGTACATGGTCAACGGCGAGGGCCACGCCTCCTGCGACCACCGCCAGCG
CGGCTTCAAGCGCTGGGAGTGCAACCGGCCCGCGGCGCCCGGGGGGCCGCTCAAGTTCTC
GGAGAAGTTCCAGCTCTTCACGCCCTTCTCCCTGGGCTTCGAGTTCCGGCCCGGCCACGA
GTATTACTACATCT
gtgagtggggtcgggccggggctgccggggcccgagtgggcggggacgcgggggcggggc
caggaagtgggcgggaccactggggtggggccggggagtgggcggggcagcgcagtgggc
ggggccgcggtgtggggccaggggggagtgggcggggccgcggaatggggccagggggga

 3.03 Intr +  13583  13648   66  0  0  112  100    94 0.998  13.02
agactgctgggaaacagggggcattgtgtctggggctttgatgtacgattaggagtttta
agggtggctctccacctggggtcagggttgattcaccaaggtggggaagggagtacagcc
ccaggaggtctcaggcaccaagaggcacttccccactcatccccatcccctctcttctag
CTGCCACGCCTCCCAATGCTGTGGACCGGCCCTGCCTGCGACTGAAGGTGTACGTGCGGC
CGACCA
gtaagtgctcagggggatgggcaggatccaggcccccacccctgtgtcctaaacccacag
aaccagtgagtgttcagaagagccaggacagggggcctcgggtttccctatcttgccctg
ccttgccccagcctcgatttccccgtctgatgaacatgtcagaccttcgagagtgaaggt

 3.04 Term +  14856  14977  122  1  2   94   37   146 0.964   9.67
tcaggccaagtgactttgcccggagagtgggcatcggggatggcaccaagagggagcaga
gggcctgcctggtggggtgatgagcccgttgggcagatgtgcaccctgagggcgggcggc
acgtggggagcccagtggggttcgggcggccgctgagcgtgctgtctctgccacccgcag
ACGAGACCCTGTACGAGGCTCCTGAGCCCATCTTCACCAGCAATAACTCGTGTAGCAGCC
CGGGCGGCTGCCGCCTCTTCCTCAGCACCATCCCCGTGCTCTGGACCCTCCTGGGTTCCT
AG
tcccagccccgcaggacgccgaccctgcctggacggccccgcctggaccgcctgacctcg
gccctccggacccggctgcggcccccgcctccgagaccaaatagagacgctgcttctccc
tcgcctggtgccgcccccgccgggcaggggccatccacccgccccaggaccagccctcag

Predicted peptide sequence(s):


>EFNA2_1|GENSCAN_predicted_peptide_1|79_aa
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRSPDELGEVGVSLP
QDPASASLQGAKGPALKGD

>EFNA2_1|GENSCAN_predicted_peptide_2|437_aa
MSPLTEDWSFSSCSGPGWDLKGNQSPGWCKVCPRKDKYGLVVQEGLSLASPGPAPGGTPW
TLPNFRVALGPPPGSPSAPNAEWTSFSQTKQKTLMQQNTASPPSKPAPREAEGRQRSHGE
RDTPFTSALCWGTAPPSGSEPLHRSPFSIQCLRGTRLLPTPEGHWVRGEPREGGRSPEMP
SVGKRPPSAPKAADFQSEDTCNLQPDATPGTPARHPSPPLHANTHEQPWECTRGVVARTG
EGSRPGPTGQGPLGYGGPAPPPAVPDTPATQAQVPGRCPWTPNLRTAETPDVRDKALILA
GSRLPGKVLTQPWAPLQGVGSVPSNPGYRRQERKEEAASVLPRSALRTSKAVPSGSGLSW
ATRSDPEQQEVAGPSQALGRPLPSPGRGSGPQPTALWQVGQQDGPGDHLPPPVAGSSCVW
RLLEQRTGHAGDGRFRS

>EFNA2_1|GENSCAN_predicted_peptide_3|182_aa
MKEAWEALCPWTNPTRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVL
YMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYI
SATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLL
GS