GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:09:44

Sequence DNASE2_1 : 8657 bp : 54.44% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1294   1379   86  0  2   66  105   216 0.956  19.39
cctctccaaaacgcagcatcgcgtctcgggggaggagtctgtaccctcgtgatgtccccg
ccccggttcccaggcaagtttagggaagtgaaaggcgccaggtgccagtcctggcctctg
atgtaacccagcgccccgcagtcccgacacagattcctggatctcagccccatagcagct
ATGATCCCGCTGCTGCTGGCAGCGCTGCTGTGCGTCCCCGCCGGGGCCCTGACCTGCTAC
GGGGACTCCGGGCAGCCTGTAGACTG
gtgagtgcgcagcggggggcctaccatcgccccggggtccggctgcggtcactcaaccgg
gatggctacctcctcggggaaccctggggtgccttctcttccctctctcctatttctgtg
cattctccgacctccaggttcgtggtctacaagctgccagctcttagagggtccggggag

 1.02 Intr +   1517   1697  181  2  1   93   72   294 0.999  28.69
gggccctgacctgctacggggactccgggcagcctgtagactggtgagtgcgcagcgggg
ggcctaccatcgccccggggtccggctgcggtcactcaaccgggatggctacctcctcgg
ggaaccctggggtgccttctcttccctctctcctatttctgtgcattctccgacctccag
GTTCGTGGTCTACAAGCTGCCAGCTCTTAGAGGGTCCGGGGAGGCGGCGCAGAGAGGGCT
GCAGTACAAGTATCTGGACGAGAGCTCCGGAGGCTGGCGGGACGGCAGGGCACTCATCAA
CAGCCCGGAGGGGGCCGTGGGCCGAAGCCTGCAGCCGCTGTACCGGAGCAACACCAGCCA
G
gtgaagggggccccgggccaactaggggcgaaactctagggctgccctgcctgggaggaa
tttcacgttgcctccgtttatccgcccgcagctcgccttcctgctctacaatgaccaacc
gcctcaacccagcaaggctcaggactcttccatgcgtgggcacacgaagggtgaggcctg

 1.03 Intr +   1789   1918  130  0  1   87   86    76 0.878   8.07
gctggcgggacggcagggcactcatcaacagcccggagggggccgtgggccgaagcctgc
agccgctgtaccggagcaacaccagccaggtgaagggggccccgggccaactaggggcga
aactctagggctgccctgcctgggaggaatttcacgttgcctccgtttatccgcccgcag
CTCGCCTTCCTGCTCTACAATGACCAACCGCCTCAACCCAGCAAGGCTCAGGACTCTTCC
ATGCGTGGGCACACGAAGGGTGAGGCCTGGATTGGGGGCTGGGGAGAGACTCGGGTCCCA
TTTTTCCAAG
gtaacccctgacgtgcatggggtggtcggggagatctgcactgtcagaccctgggcatct
attccccccaacttttttttttctttgtttttgagacggtgggagttcgctctgtcaccc
aagctggagtgcagtggcacaatcttggctcactgcaatctctgcctctggggttgaagc

 1.04 Intr +   3835   3999  165  2  0   95  106    34 0.965   6.35
tccaccaccacgctcagctaatttttgtatttttagtagagatggggtttcgccatgttg
gccaggctgatttctaactcctgacctcaggtgatctgtgtgtctcggtctcccaaagtg
ctgggattacaggcgtgagccactgcgcccgacctcccctaatgccttcttttggtccag
GTGTCCTGCTCCTTGACCACGATGGGGGCTTCTGGCTGGTCCACAGTGTACCTAACTTCC
CTCCACCGGCCTCCTCTGCTGCATACAGCTGGCCTCATAGCGCCTGTACCTACGGGCAGA
CCCTGCTCTGTGTGTCTTTTCCCTTCGCTCAGTTCTCGAAGATGG
gtaagtcgagtcagggacacaggatgagtcctgggtttactgaccagaacctggaacgat
cttgcatttcctcctccccttgtcctccaggcaagcagctgacctacacctacccctggg
tctataactaccagctggaagggatctttgcccaggaattccccgacttggagaatgtgg

 1.05 Intr +   4090   4287  198  2  0   88  101   226 0.999  23.74
ctgctgcatacagctggcctcatagcgcctgtacctacgggcagaccctgctctgtgtgt
cttttcccttcgctcagttctcgaagatgggtaagtcgagtcagggacacaggatgagtc
ctgggtttactgaccagaacctggaacgatcttgcatttcctcctccccttgtcctccag
GCAAGCAGCTGACCTACACCTACCCCTGGGTCTATAACTACCAGCTGGAAGGGATCTTTG
CCCAGGAATTCCCCGACTTGGAGAATGTGGTCAAGGGCCACCACGTTAGCCAAGAACCCT
GGAACAGCAGCATCACACTCACATCCCAGGCCGGGGCTGTTTTCCAGAGCTTTGCCAAGT
TCAGCAAATTTGGAGATG
gtgagtctcaaggttgagggttggagagctccttctctgcagacagggtgactggtgtgg
ccatggctgagttcaagtcagcggtagagaccaggtctgtttgggagctataatcacatg
atcagtgaacagacctgggttcaaaccctgggttttgctgtgtgatgtataacttcacct

 1.06 Term +   6306   6679  374  1  2  138   40   338 0.999  29.21
aggttgcaatgagcctagattgcaccaatgcactctagcctgggcgacagagcaagactc
catgtcaaaaaaaaaaaaaaaaaaggaaatatggaaactgagctgagagaggggaagtgg
actagggactccctcgcagtggccctgaccctacctgtgccctctctccatcctttgcag
ACCTGTACTCCGGCTGGTTGGCAGCAGCCCTTGGTACCAACCTGCAGGTCCAGTTCTGGC
ACAAAACTGTAGGCATCCTGCCCTCTAACTGCTCGGATATCTGGCAGGTTCTGAATGTGA
ACCAGATAGCTTTCCCTGGACCAGCCGGCCCAAGCTTCAACAGCACAGAGGACCACTCCA
AATGGTGCGTGTCCCCAAAAGGGCCCTGGACCTGCGTGGGTGACATGAATCGGAACCAGG
GAGAGGAGCAACGGGGTGGGGGCACACTGTGTGCCCAGCTGCCAGCCCTCTGGAAAGCCT
TCCAGCCGCTGGTGAAGAACTACCAGCCCTGTAATGGCATGGCCAGGAAGCCCAGCAGAG
CTTATAAGATCTAA
cccttatggccaggtgcagtggctcacgtatgtaatcccagcactttgggaagccaagga
gggaggatcacttgaactcaggaattcgagaccagcctgggctacatagtgagaccacat
ctctactagaacttaaaaaaagttagccaggcacggtgataaatgcctgtagtcccagcc

 2.02 PlyA -   7741   7736    6                               1.05
 2.01 Term -   8536   7799  738  1  0   48   42   541 0.760  39.41

Predicted peptide sequence(s):


>DNASE2_1|GENSCAN_predicted_peptide_1|377_aa
MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGG
WRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGEAWI
GGWGETRVPFFQGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSACTYGQTLLCVSFP
FAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEPWNSSITLTSQAGA
VFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPG
PAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKN
YQPCNGMARKPSRAYKI

>DNASE2_1|GENSCAN_predicted_peptide_2|245_aa
VAVRRLGRQESPLSLGADPLLPEGASRPPVSSKEKESPGGAEACTPPRATTPGGRTLERD
VGCTRHQSVQTEDGTGGMARAVAKAALSPVQEHETGRRSSSGEAGTPLVPIVVEPARPGA
KAVVPQPLGADSKGLQEPAPLAPSVPEAPRGRERWVLEVVEERTTLSGPRSKPASPKLSP
EPQTPSLAPAKCSAPSSAVTPVPPASLLGSGTKPQVGLTSRCPAEAVPPAGLTKKGVSSP
APPGP