GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:05:16

Sequence DEDD2_1 : 21461 bp : 52.73% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1855   2182  328  0  1   77   96   531 0.536  50.29
cgggggagggggaggccgaggcggttgggggtgcgggagcggccctgcccggcgcgattg
ggcgggggagacgcgctggcggtgtggggttcgggcctccgcgtcgctgaccactgcccc
ctccccgctgtgtgggttctaggccgggttctgagcttgttccgcctccctcccccggga
ATGGCGCTATCCGGGTCGACCCCGGCCCCGTGCTGGGAGGAGGATGAGTGCCTGGACTAC
TACGGGATGCTGTCGCTTCACCGTATGTTCGAGGTGGTGGGCGGGCAACTGACCGAGTGC
GAGCTGGAGCTCCTGGCCTTTCTGCTGGATGAGGCTCCTGGCGCCGCCGGAGGCTTAGCC
CGGGCCCGCAGCGGCCTAGAGCTCCTGCTGGAGCTGGAGCGCCGCGGGCAGTGCGACGAG
AGCAACCTGCGGCTGCTGGGGCAACTCCTGCGCGTGCTGGCCCGCCACGACCTGCTGCCG
CACCTGGCGCGCAAGCGGCGCCGGCCAG
gtacggttgaatgggagggtgtcacacttcctgggaggaaagggcctggctcccgctggg
cctccctggtgccctgatacggacagtgccatatcaggcagcttatgtcccattctgcta
ctctctcttcccacaatatcaatgagcaacataagaggaagaaagcatggctttgggaat

 1.02 Intr +   3610   3729  120  2  0  107   99    61 0.920  10.07
gataagttctctctcttaggaggcatctgagcaacctctgcaggaggtgtttgagaatga
gtgggtatttgggctctgactactggggaacttaggcacctcgtggtgcaggcattcttc
caggggtgggaattagggccaggaggctgaatgcttcttcctgttcttctcttcctccag
TGTCTCCAGAACGCTATAGCTATGGCACCTCCAGCTCTTCAAAGAGGACAGAGGGTAGCT
GCCGTCGCCGTCGGCAGTCAAGCAGTTCTGCAAATTCTCAGCAGGGTCAGTGGGAGACAG

gtgagcccagctgggtgggtgtaatggcagcatccctcttttccttatgaattgtgccca
tcaaggaaggggcctgaggggttattctgtctcattttcactgtgtgtgtgtgtgtgtgt
gtgtgtgtgtgtttattgctacagatactctgttctgaagcaacatacagaattgttgca

 1.03 Intr +   9022   9162  141  2  0  128   66    72 0.818   9.83
ccttctagatgatgctagatggtactcttcatcttttagacagggccactgaagaaggga
ggcagactggctcactcagggtctcagcaccgagaacaccttgagttcttttccaggcat
acacctgggcactctagctgtcatcctggtcctcaacttgccccatttttttcccctcag
GCTCCCCCCCAACCAAGCGGCAGCGGCGGAGTCGGGGCCGGCCCAGTGGTGGTGCCAGAC
GGCGGCGGAGAGGGGCCCCAGCCGCACCCCAGCAGCAGTCAGAGCCCGCCAGACCTTCCT
CTGAAGGCAAAGTGACCTGTG
gtaggtgtctgtaggctttggcaatgcatgtagagtgccccgggtgggttcagagggtgg
gagaaatgagcatttttctgggggatgtgacacacttggcagatgggtgtcagctctcgt
tcaccacagtggaattcttgtcctttctctcgccatcttgcctgtctacatcctgtccat

 1.04 Term +  19033  19424  392  2  2  152   42   559 0.992  53.22
ggagaagaggaggacgtacttggtcagggaaccccacagagccggggaggctgtgtcagg
actagggtgtggctaccggaagggggtggagggagaaggctggagggaggaagggtggcg
ttccccataagtgtgtctagtgttggccccctccctgacaaatccctccttcccctgcag
ACATCCGGCTCCGGGTTCGAGCAGAGTACTGCGAGCATGGGCCAGCCTTGGAGCAGGGCG
TGGCATCCCGGCGGCCCCAGGCGCTGGCGCGGCAGCTGGACGTGTTTGGGCAGGCCACCG
CAGTGCTGCGCTCAAGGGACCTGGGCTCTGTGGTTTGTGACATCAAGTTCTCAGAGCTCT
CCTATCTGGACGCCTTCTGGGGCGACTACCTGAGTGGCGCCCTGCTGCAGGCCCTGCGGG
GCGTGTTCCTGACTGAGGCCCTGCGAGAGGCTGTGGGCCGGGAGGCTGTTCGCCTGCTGG
TCAGTGTGGATGAGGCTGACTATGAGGCTGGCCGGCGCCGCCTGTTGCTGATGGAGGAGG
AAGGGGGGCGGCGCCCGACAGAGGCCTCCTGA
tccaggactggcaggattgatcccacctccaagtctccgggccaccttctcctgggagga
cgaccatctctacccctagaggactgtcactctagcatctttgaggactgcgacaggacc
gggacagcaggccccttgacagcccctcccacaggatgtgggctctgaggcctaaaccat

Predicted peptide sequence(s):


>DEDD2_1|GENSCAN_predicted_peptide_1|326_aa
MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTS
SSSKRTEGSCRRRRQSSSSANSQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQ
QQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVLR
SRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSVD
EADYEAGRRRLLLMEEEGGRRPTEAS