GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:42:56

Sequence CPT1C_1 : 24981 bp : 53.30% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    157    325  169  2  1   94    0   151 0.041   6.42
gagaccgtaaagggcgagcgccctctcccggccgcggaacgggcaggtgatctgtaagcc
tccccgctggtcttggagtgcttgggtgcccacctccatcacgctccatctctcaattcg
gtttgaacccggttttctcccacgctccctctccagGCGAGGCCAGCACCAGGTCCCCCAGCACCGCGGGCACGTCTGCTACCTGGGCGTATGCCG
GACCCACCGCCTGGCGGAGATCATATACTGGATTCGCTGTCTCCACCAAGGAGCCCTCGG
GGAAGGCCAGCCACGAGCCCCAGGACCCCTACAGCTATGGGCGCCGCCG
gtggcgcgaggcggaagcccggctcggttcccaggattccggcctgcagcgagggggcta
gcgcagtgcccagctcgctgggtgacctcgggcacggctcgtcccctcctcggcttcagt
ttgcctatctgtatgttggagcttctactccacatttcttctcccctaactccagcccct

 1.02 Intr +   1237   1391  155  1  2   25  103    56 0.046   1.03
agacggaggactggggatcgaacggatgtaggggattggacgccgtggctcgaagggggc
ggggatagaacgcggggattggaaggaggcggggataaaacccgggacctgaatacccgg
ctagggacacgagagagaggaatcggggtttctgggtgacggtgatctcggggtgggcag
GACTCCAAAGGCCCGTCGACCCGGTGGTGGACTCCTTGCACTGGGATTGGACATATGCAA
GCGGGAGATTTGGGGCCGGCGCTCAAAATCGGGGGGCGGGGGTGGACTCGGGTTTGGACC
CCAGGATCCGATCAGCGGACCCTTGATTCAACGTG
gtaagtactggaccccaggggctcgggctccggcggggcctggagtcctgtgtctagggt
tgggcgtgcaagcctctccatcacttgtcctcgacgctcgcctccgctcacagcctcagc
atcccaggctgcgaggcatgcgcagtgggtgcttccttccccattccctccagcacgggc

 1.03 Intr +   2290   2444  155  2  2   58   68   163 0.038  11.60
gggcctgggcttctgggtctgagggaggaggggctgggggcctggactcctggatctgag
agaggagggactggggcctggactcctgggtatgaaggaggaggaggggctgggggcctg
gactcctgagtctgagggcggaggggctggggtcctgaagtatgactctgcccgactcag
GGCTCCAGCGTGACATGGCTGAAGCGCACCAGGCCGTGGGCTTCCGACCCTCGCTGACCT
CGGACGGGGCTGAAGTGGAACTCAGTGCCCCTGTGCTGCAGGAGATCTACCTCTCTGGCC
TGCGCTCCTGGAAAAGGCATCTCTCACGTTTCTGG
gtgaggagcggtgctggtcggtttccttccggggatccaggtttctgcttccgggatgtc
tgaggctcacttccggcatttcagctggttcatttctgggagactatcacccctttttct
tagaattttgatgtctgctcccaggacccctttagcaatttctccgtggctcacttctgg

 1.04 Intr +   7377   7516  140  2  2  118   81    75 0.873   9.57
ttacttcattctggtctgacctcgctgagggcaggacctggatctctctgttccctacta
gatcttgagcctccagctcagggctccgcactgggtgctcagtaatgtctggggatggca
cagaacaggggctcagaggagagggcagatgattcaatggatgccctttcctccccacag
AATGACTTTCTCACCGGTGTGTTTCCTGCCAGCCCCCTCAGTTGGCTTTTCCTCTTCAGT
GCCATCCAGCTTGCCTGGTTCCTCCAGCTGGATCCTTCCTTAGGACTGATGGAGAAGATC
AAAGAGTTGCTGCCTGACTG
gtgaggtccccccactccagcccagtaacccccaatcactctcccttcacccagtaagtt
cctctgtcattgtggtgtacctgctaaagaaaagtaacctctgagacttacattgggtca
gattaataaaggcatggcatgaagaaaaaggaggtgaggccgggcacagtggctcacccc

 1.05 Intr +  10735  10906  172  1  1  128   60    96 0.999  11.26
ggtgctgccacaatgggagggggctggagggggtgacagagctcacacctactaaaatga
caaaaatgggtttctctgtctgacagccaaaagatcagcgcaggggctggagggggctgg
aagggagggaggttctgaggccaggagacccaggcccagcctctgtttctctccccgcag
GGGTGGACAACACCACGGGCTCCGGGGGGTCCTGGCAGCCGCGCTGTTTGCCTCGTGTTT
GTGGGGAGCCCTGATCTTCACACTGCACGTGGCCCTGAGGCTGCTTCTGTCCTACCACGG
CTGGCTTCTTGAGCCCCACGGAGCCATGTCCTCCCCCACCAAGACCTGGCTG
gtatgggaggggcatagccctgctcaggctctcctgggacccgcttatctattcccctct
ctctgggtctctgtccccctctctctgggtctctgtccctctctctctgggtctcttccc
cctctctttctgggtctctgtcctcctctgtccctgggtctctgtccccctctctctggg

 1.06 Intr +  11368  11469  102  0  0  120   86   158 0.999  19.67
ccctctctctgggtctctgtcccctgtctctgggtctctgttcctttctctcttggggtc
tccgatgctcttaagtctctgtgtccttctctttgggtttctgtcccactgtcgacccct
gccccgtcaactccctggctccggtgaggggttaatgacccggtaactcctcctccccag
GCCCTGGTCCGCATCTTCTCTGGCCGCCACCCGATGCTGTTCAGTTACCAGCGCTCCCTG
CCACGCCAGCCCGTGCCCTCTGTGCAGGACACCGTGCGCAAG
gtgggcctgggagcgcgcagacgggctggggcggccggggcgggccgggggcgtgacctg
ccctcttctcccctttagtacctggagtcggtccggcccatcctctccgacgaggacttc
gactggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcgctgctgcagtgg

 1.07 Intr +  11548  11685  138  0  0  121   73   237 0.997  26.67
gccctggtccgcatcttctctggccgccacccgatgctgttcagttaccagcgctccctg
ccacgccagcccgtgccctctgtgcaggacaccgtgcgcaaggtgggcctgggagcgcgc
agacgggctggggcggccggggcgggccgggggcgtgacctgccctcttctcccctttag
TACCTGGAGTCGGTCCGGCCCATCCTCTCCGACGAGGACTTCGACTGGACCGCGGTCCTG
GCGCAGGAATTCCTGAGGCTGCAGGCGTCGCTGCTGCAGTGGTACCTGCGGCTCAAGTCC
TGGTGGGCGTCCAATTAT
gtgagtcccgccaccgccaccaacgccccacctgaagggctaaggttgtgagctcgcctg
ctaaacttgcgagttatacgccctgccccacgacacgcccacaacccacacgcccccagc
ccccaagggtcaataccctgagccccgctcacatacatctatatcctaacctccacattt

 1.08 Intr +  14761  14838   78  0  0  119   81   132 0.917  15.84
gctaactgatcccccatggatggatttctaggtgatcgctagttactgactacgatggct
gacttctttggctctatcctccctgcctgacgcaggagcatctggggccttccctgtcct
actgtccctcccccaacaggccccagcccctcactgtgtgtctccccaccccgctcccag
GTCAGTGACTGGTGGGAGGAATTTGTGTACCTGCGCTCCCGAAATCCGCTGATGGTGAAC
AGCAACTATTACATGATG
gtgagaaggggaggggtgaggttcataggccccaggtctagggttggggggtacctgggc
ggaatgtgacggtcatgctcagtgacctggatctagacgcgccatctgggattcatcatt
ccaccctcttttggggtcaggacctgtatttgggtcagtggctccatcgggggcaaacct

 1.09 Intr +  15058  15349  292  0  1  112  100   234 0.835  24.25
agggttggggggtacctgggcggaatgtgacggtcatgctcagtgacctggatctagacg
cgccatctgggattcatcattccaccctcttttggggtcaggacctgtatttgggtcagt
ggctccatcgggggcaaacctgaccctgggtgttttgccatcccctctcctggtccccag
GACTTCCTGTATGTCACACCCACGCCTCTGCAGGCAGCTCGCGCTGGGAATGCCGTCCAT
GCCCTCCTCCTGTACCGCCACCGCCTGAACCGCCAGGAGATACCCCCGGTGAGAGGGCCC
CAGTGGGTTAGGGATGGAGGTGTGGTCCTGTGGCCTTTGGGCCACGTGGGTCCTGGAAGG
CAGCTCACAGCCCACGGTTTCCTGCAGACTTTGCTGATGGGAATGCGCCCCTTATGCTCT
GCCCAGTACGAGAAGATCTTCAACACCACGCGGATTCCAGGGGTCCAAAAAG
gtgagaccctctcctgtccccactgatggaggcagaacaatatagtggctaagagcatgt
tttctggagtccgcctgactgagctgggaaccattgcttccttgctgtgtgaccttctgc
acgttattaccctctctgagcctcagcttccactaaagtgggataataattgtacctagg

 1.10 Intr +  15960  16155  196  1  1   72  110   252 0.999  24.79
cagcctggcgacagagcgagaccttgtctccaaatactaagtaaataaaagtcctagggt
gctgatgattactagggtactttgaacaactgacgacacctaagaagtatataataaatg
gtcactatttttatgtgtctggccttcctgcccccatgcttctgccaacgccacccctag
ACTACATCCGCCACCTCCATGACAGCCAACACGTGGCTGTCTTCCACCGGGGCCGATTCT
TCCGCATGGGGACCCACTCCCGAAACAGCCTGCTTTCCCCGAGAGCCCTGGAGCAGCAGT
TTCAGAGAATCCTGGATGATCCCTCACCGGCCTGCCCCCACGAGGAACATCTGGCAGCTC
TGACAGCTGCTCCCAG
gtaagggtcaggggtcaggggtcaggggctctcagaggccgccagtgtcctgagactgtg
gaagggcagggtggggccaggtggcggctgggcaggatggactcaggcacatcccgggcc
ctccaggggcacgtgggcccaggtgcggacatccctgaagacccaggcagcggaggccct

 1.11 Intr +  16282  16464  183  1  0   37  109   202 0.999  16.62
ctcaccggcctgcccccacgaggaacatctggcagctctgacagctgctcccaggtaagg
gtcaggggtcaggggtcaggggctctcagaggccgccagtgtcctgagactgtggaaggg
cagggtggggccaggtggcggctgggcaggatggactcaggcacatcccgggccctccag
GGGCACGTGGGCCCAGGTGCGGACATCCCTGAAGACCCAGGCAGCGGAGGCCCTGGAGGC
GGTGGAAGGGGCCGCTTTCTTTGTGTCACTGGATGCTGAGCCCGCGGGGCTCACCAGGGA
GGACCCGGCAGCGTCGTTGGATGCCTACGCCCATGCTCTGCTGGCCGGCCGGGGCCATGA
TCG
gtgagtgagtcttgggatggggcccccagatgtggcacccgagaatccagtatcagacct
aggacccctgacagtagacagccagaccctggagcccacacctgcagagtctgtagacca
ggggctgcatagagctgaggaccccagacccagtgctttgggacctggagacctctgacc

 1.12 Intr +  17569  17674  106  1  1   75   75   111 0.999   9.22
gtcttggagacctccagggccactactggggacccccaatggtcctagagatccccatac
cagcaccccaatggattcccacatcttcccatctagaaaaccccctcaagtcccacagaa
agcactctgaggtccccgtgcccctcgctcttggtgacccatctgaactctccctgacag
CTGGTTTGACAAATCCTTCACCCTAATCGTCTTCTCTAACGGGAAGCTGGGCCTCAGCGT
GGAGCACTCCTGGGCCGACTGCCCCATCTCAGGACACATGTGGGAG
gtagggcggccagccctccctggttctggggacccctgccccatctccaaagaccgtcct
ctccagcgccttagtgtcagaagaaaaactgaggcttggccgggcacggtggttcatgcc
tgtaatcccagcattttgggaggccgaggtgggcggatcatgaggtcaggagttcgagac

 1.13 Intr +  18774  18890  117  2  0   73   94    92 0.996   9.47
ttggtgttagtcctgttcttgatgaacatgaacctgagaccgcatctgtgaatatcagag
gtttctgtttctcagggactgccccctacccgaaaaagggctgcatgaaaagaggtcccg
ggttagatggcctcagtccacagggaggaagggactctaacagcctctgtttgcccacag
TTCACTCTGGCTACAGAATGCTTTCAGCTGGGCTACTCAACAGACGGCCACTGCAAGGGG
CACCCGGACCCCACACTACCCCAGCCCCAGCGGCTGCAATGGGACCTTCCAGACCAG
gtgaggctgggtttctgggcctctcctccaagtcccaagattcctagccttgacttcaaa
ctcatccccacccctaatctgaacgtgaaaatcaaccccattcctacccccaacccgaaa
cccatgcttcccccacccccaaatcaggccatatgcatccacaacctcaaaccccaacac

 1.14 Intr +  20371  20535  165  0  0  113   60   166 0.984  16.97
gcccagcccctatccccatctttagtctcatccttcaattctcttctcttctttgtcccc
atttccatattctgccgcaaccttaactccacatccacctccgcttccagccttattcct
ggctttcaccctacccccatctgtaaccccaactactcctcttccctcctcctctggcag
ATCCACTCCTCCATCTCTCTAGCCCTGAGGGGAGCCAAGATCTTGTCTGAAAATGTCGAC
TGCCATGTCGTTCCATTCTCCCTATTTGGCAAGAGCTTCATCCGACGCTGCCACCTCTCT
TCAGACAGCTTCATCCAGATCGCCTTGCAACTGGCCCACTTCCGG
gtcagttgggttccccatccacagcccccgcagggtctcagtccacctgagcccccaaga
cctgcccctccacggttccttgtggtcgctgccattgtgggtcggccatcttgaattctc
tcttccaaccattcttgggctggctggaggaggctggaggtctggacagagataggtcaa

 1.15 Intr +  20774  20908  135  1  0  145   76   109 0.998  16.67
gacctgcccctccacggttccttgtggtcgctgccattgtgggtcggccatcttgaattc
tctcttccaaccattcttgggctggctggaggaggctggaggtctggacagagataggtc
aagtctgtaagatctcctgagcccagctgacagactcctcttctcctccctgtcccccag
GACAGGGGTCAATTCTGCCTGACTTATGAGTCGGCCATGACTCGCTTATTCCTGGAAGGC
CGGACGGAGACGGTGCGGTCTTGCACGAGGGAGGCCTGCAACTTTGTCAGGGCCATGGAG
GACAAAGAGAAGACG
gtgggtgcagccctcgcttgaggcttcagttatttctgtgtactcactcatccacttgca
aacgttgatgggacctactgaagccagcctccacgaggagcacaagggacaagggatgaa
tcggacctggcctctgacttcaaagagctcactgatggggggagacagcccagcatagtg

 1.16 Intr +  21860  22012  153  1  0   58   47   228 0.991  16.48
gtgtgaacctggccaaatgatttcccctctctaagcctcagttccccatctgtaaaatgg
ggttgatattcccaccttgcagggatgtggcaaactcagttgaggccagatgtgccgcag
gcccagccctaagtcgacttcctgtctttccatgacctgtgacctccctggggactgcag
GACCCACAGTGCCTCGCCCTGTTCCGCGTGGCAGTGGACAAGCACCAGGCTCTGCTGAAG
GCAGCCATGAGCGGGCAGGGAGTTGACCGCCACCTGTTTGCGCTGTACATCGTGTCCCGA
TTCCTCCACCTGCAGTCGCCCTTCCTGACCCAG
gttggggcacagggaaagggttagagagggaagtgggagaccatggaagaagggagaggt
ttcagggaaggagggtgatgttgaaaaaggacccatcaaggccgggcacggtggctcacg
cctgtaatcccagcagtttgggaagccgaggcaggcggatcacttgaggtcaagagttcg

 1.17 Intr +  22787  22900  114  1  0   85   76   129 0.999  12.55
gtggtgagacgagtgaggggcgtggccagatagggcgtggtcaggagaagggcgtggtta
gggagaaggaggcccggatttacgggtaaaaaaaaagccagggatgcagggagtgaagtg
gagccaagggccggaactgcagatctctgtcctgcacatgtgatgggctcctgtcctcag
GTCCATTCGGAGCAGTGGCAGCTGTCCACCAGCCAGATCCCTGTTCAGCAAATGCATCTG
TTTGACGTCCACAATTACCCGGACTATGTTTCCTCAGGCGGTGGATTCGGGCCT
gtgagtggagctgggcgcgctggcccccagaggaaagagggggctggggggcctgcactc
ctgcatagtgggggtggaggggaccggagctattttcttcccttcactctttccgtctcc
aggctgatgaccatggttatggtgtttcttatatcttcatgggggatggcatgatcacct

 1.18 Intr +  23023  23115   93  0  0  105   93    90 0.999  11.86
tctgtttgacgtccacaattacccggactatgtttcctcaggcggtggattcgggcctgt
gagtggagctgggcgcgctggcccccagaggaaagagggggctggggggcctgcactcct
gcatagtgggggtggaggggaccggagctattttcttcccttcactctttccgtctccag
GCTGATGACCATGGTTATGGTGTTTCTTATATCTTCATGGGGGATGGCATGATCACCTTC
CACATCTCCAGCAAAAAATCAAGCACAAAAACG
gtgagacaaacgtgtatacccaccaactccctctttcctcaggaaccaggagtctgggcc
cccagcccctcctccctcagacccaggattccaggccccagcccctcctccctcagaccc
aggagtccaggcccccagcccctcctccctcagacccgggagtccaggcccccagcccct

 1.19 Term +  23471  23656  186  1  0  129   41    55 0.676   2.71
cccctcctccctcagacccgggagtccaggcccccagcccctcctccctcagactcggga
gtccaggccccagctcctcctccctcagactcaggaatccaggcccttagccctcttgtt
tctcagcctccaggatcccatctcccagcttcccctggctctgacctgttctccttccag
GATTCCCACAGGCTGGGGCAGCACATTGAGGACGCACTGCTGGATGTGGCCTCCCTGTTC
CAGGCGGGACAGCATTTTAAGCGCCGGTTCAGAGGGTCAGGGAAGGAGAACTCCAGGCAC
AGGTGTGGATTTCTCTCCCGCCAGACTGGGGCCTCCAAGGCCTCAATGACATCCACCGAC
TTCTGA
ctccttccagcaggcagctggcctctccaaggaataagggtgaaattgccacagctggct
gacacaggacaggggcaactggtttggcaaccccacatccaggccaataaagatgtgtga
gctgggtgtgtggtgtctgctatgctcttgggcagggcaggggtagaagaggtaaggacc

Predicted peptide sequence(s):


>CPT1C_1|GENSCAN_predicted_peptide_1|949_aa
XEASTRSPSTAGTSATWAYAGPTAWRRSYTGFAVSTKEPSGKASHEPQDPYSYGRRRTPK
ARRPGGGLLALGLDICKREIWGRRSKSGGGGGLGFGPQDPISGPLIQRGLQRDMAEAHQA
VGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPLSWLFLFS
AIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIFTLHVALR
LLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQDTVRKYL
ESVRPILSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFVYLRSRNP
LMVNSNYYMMDFLYVTPTPLQAARAGNAVHALLLYRHRLNRQEIPPVRGPQWVRDGGVVL
WPLGHVGPGRQLTAHGFLQTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVA
VFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVR
TSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSF
TLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATECFQLGYSTDGHCKGHPDPTLPQPQR
LQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCHLSSDSFIQIALQLA
HFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACNFVRAMEDKEKTDPQCLALFRVAV
DKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLF
DVHNYPDYVSSGGGFGPADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDA
LLDVASLFQAGQHFKRRFRGSGKENSRHRCGFLSRQTGASKASMTSTDF