GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:39:48

Sequence CD37_1 : 7466 bp : 57.25% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    954   1016   63  2  0   87   81     6 0.503   1.05
agagacccagggcaggaaatgggagacacagctggatgcagagatgggagagcttagcag
gccatgaggtcagagtgtctgtgaggtcagctgctgtccagggtcagccctgaggtcccc
atgcccagaggtgggttccagtagatcaggggtccctttagatcccccagcgcctgagac
ATGGAGACCTGGGAGGGACTGCCCCATGAGTCCTTGGTGCCCACAAATTCCAAGGCCCCT
CAG
gtaccagagcatgtgtcccagtggagcaggtgagggagacagggacagagagagagacag
aaagccaccttacatgaagcgggagtgggtggagccccacccctggaacttcctcttttg
gggttcttcctttctctctcagctctccgtctctctttctctctcagcctctttctttct

 1.02 Intr +   1258   1332   75  0  0   62   69    66 0.674   2.96
aagccaccttacatgaagcgggagtgggtggagccccacccctggaacttcctcttttgg
ggttcttcctttctctctcagctctccgtctctctttctctctcagcctctttctttctc
cctgtctcccccactgtcagcacctcttctgtgtggtgagtggaccgcttaccccactag
GTGAAGATGTCAGCCCAGGAGAGCTGCCTCAGCCTCATCAAGTACTTCCTCTTCGTTTTC
AACCTCTTCTTCTTC
gtgagttgcctcatggctacccagccggggcccagcccctgccgctaacccagccctcat
cttcccctgtggcccacccccgtatccgcatctcctctccccaggtcctcggcagcctga
tcttctgcttcggcatctggatcctcattgacaagaccagcttcgtgtcctttgtgggtg

 1.03 Intr +   1437   1509   73  2  1  132   68   137 0.769  16.23
ggtgaagatgtcagcccaggagagctgcctcagcctcatcaagtacttcctcttcgtttt
caacctcttcttcttcgtgagttgcctcatggctacccagccggggcccagcccctgccg
ctaacccagccctcatcttcccctgtggcccacccccgtatccgcatctcctctccccag
GTCCTCGGCAGCCTGATCTTCTGCTTCGGCATCTGGATCCTCATTGACAAGACCAGCTTC
GTGTCCTTTGTGG
gtgaggggggctggggcaggtgggagggcctcccccaacccaagcaacttcctggggtct
cccttgtctcagggagacctacggtgccctactctgcaggcaggctacaggctcccatcc
actgctcaccggaggcttcttggagcctgagtcttcttccggcaaatggggttgtgcata

 1.04 Intr +   2324   2413   90  0  0   28   90   103 0.924   5.62
ggtggcacatgcctgtagtcgcagctactagggaggctgaggcaggagaatcacttgaac
ctgggaggcagaggttgcagtgagccgagatcacatcactgcactccagcctgggggaca
gagcgaggctccaactcaaaaaaaaaccctaagaaatagatatcatctcctatgcctcag
GGAGGTTTAAGGAGCCAAGCCAATGTCACAGAACAAGTGATAGGGCTGAAACTACTGGGG
ACGAGGAGGAGCTGAAGGAGGAAGGAGAGG
gtaagaggaagagagacagagatccagggacgggaaacaggcccagaaagaagagaaagt
ttcagaaggaaacagggactcagggtggggcagggacagagtcccagagagaggggcacc
aagatactgctccccacttgggtggctgcctaggtgggaaatggggctgcctggagctgt

 1.05 Intr +   2632   2756  125  2  2  102  105   153 0.999  19.88
aggcccagaaagaagagaaagtttcagaaggaaacagggactcagggtggggcagggaca
gagtcccagagagaggggcaccaagatactgctccccacttgggtggctgcctaggtggg
aaatggggctgcctggagctgtgccacacagctcatcatcactcccctcacctctcccag
GCTTGGCCTTCGTGCCTCTGCAGATCTGGTCCAAAGTCCTGGCCATCTCAGGAATCTTCA
CCATGGGCATCGCCCTCCTGGGTTGTGTGGGGGCCCTCAAGGAGCTCCGCTGCCTCCTGG
GCCTG
gtgagtgcaccatccctctccgtccctaggaacactcctatccccaccctcaaaaatggc
ctgggccggggttgcaggggtggtcagcctgatctctccactctgctccccagtattttg
ggatgctgctgctcctgtttgccacacagatcaccctgggaatcctcatctccactcagc

 1.06 Intr +   2870   2944   75  1  0   90   99   114 0.999  13.56
caccatgggcatcgccctcctgggttgtgtgggggccctcaaggagctccgctgcctcct
gggcctggtgagtgcaccatccctctccgtccctaggaacactcctatccccaccctcaa
aaatggcctgggccggggttgcaggggtggtcagcctgatctctccactctgctccccag
TATTTTGGGATGCTGCTGCTCCTGTTTGCCACACAGATCACCCTGGGAATCCTCATCTCC
ACTCAGCGGGCCCAG
gtgagcttcctgcagtggccaccacccacccccagcagggaggagagggaagggagtggt
gggagagggtggagagagaccgaaacaagggcagacaggggctaacctagataaagagaa
ataagaggctgggcctggtggctcacgcctgtaatcccataatcccagcactttgggagg

 1.07 Intr +   3648   3752  105  2  0   35  115   185 0.996  17.48
tgagccgtagaaatagtggaagaaacagaaagacagacctgaagtacacagagctagcca
ttcagtaaggatttgagactggcccagagatgcacagggcccgcctgaggctggcacagc
ctgagagggggaggggtggggcggggaagataaggcccagcctcactggtggcctctcag
CTGGAGCGAAGCTTGCGGGACGTCGTAGAGAAAACCATCCAAAAGTACGGCACCAACCCC
GAGGAGACCGCGGCCGAGGAGAGCTGGGACTATGTGCAGTTCCAG
gtaagcccccctcctccagttccctcccggactgacccgcctcagccctgtgcttggagg
agactccaccccaacgtgggcccgacccccagctctacgatcctaacacaccccaatccc
tcccaggcccgacgctccccactccccagatgacacaactgtccccggcgtcgcctggtc

 1.08 Intr +   4423   4659  237  0  0   81   64   266 0.925  22.54
tgttcccgtaatgtcccctggctccggccccatcgtgaccccagcccactgtcccccact
ccacacccaccacttagtcccctgctccccgacctgacctcatacccatcaccttgtccc
ctgatccccaacatcatatgtctccagtcccggtccctctgactcgtatccctctcccag
CTGCGCTGCTGCGGCTGGCACTACCCGCAGGACTGGTTCCAAGTCCTCATCCTGAGAGGT
AACGGGTCGGAGGCGCACCGCGTGCCCTGCTCCTGCTACAACTTGTCGGCGACCAACGAC
TCCACAATCCTAGATAAGGTGATCTTGCCCCAGCTCAGCAGGCTTGGACACCTGGCGCGG
TCCAGACACAGTGCAGACATCTGCGCTGTCCCTGCAGAGAGCCACATCTACCGCGAG
gtgggcaggggttcggagcataaacctgtcgaatggggcggggcctgcgggagggggagg
gctgtcagtgagtagcggcctgagaaagggcggggtctacgagaaaaggaaaggtacggc
aggaggggcggggccctctgaagggggcggggtctgcaggaagggcagggcctaaagaaa

 1.09 Intr +   5381   5648  268  1  1  125   15   206 0.773  15.35
cgcgtccttcggttgcctgggaaggacgagctcagggcggagcgcagcccaccccggccc
tcccgccgctccacccagcaccggagggtgggggcggcccagcttcagggagccctgatt
gggtgtacgcagggaaagcctcctgctattggctgcgatctccctcccctttctccgcag
ATGACTGTCATGGTGCTGAGCGTACAGCTACAGCGCAGGGCACTCCGCCGGAAATGCGAG
CCGCACGTGCCGGGCGCTGGGGATTCGAGCCCCGGGCCCAGCCTGATCGCTGACGGCGGC
GGCGGGCACAGCGGCAGTCTGTGGGGTGGCTGGGGCATGGCGGGTGCCTGCCCCAACTGG
GGAGACAAGGCACCGCAGGGCAAGCTGCCCATGGCCCTGGGGCTCTGGCCGCTGTGGGTT
CAAGACGAGGACCAGCCTGACACTGGAA
gtgcgggcgcagaattagaggaggcacaattagaggctgaggcagagggggaagacagat
gagcctccaaaataaaggaccctgggcttgcttccgaccttactccttctcagcctctac
ccccacttgtagcagctattcccgcctcatcagccagccctgcggcagttcccgtcgagc

 1.10 Intr +   5762   5907  146  0  2   83   51    -7 0.792  -3.71
aagctgcccatggccctggggctctggccgctgtgggttcaagacgaggaccagcctgac
actggaagtgcgggcgcagaattagaggaggcacaattagaggctgaggcagagggggaa
gacagatgagcctccaaaataaaggaccctgggcttgcttccgaccttactccttctcag
CCTCTACCCCCACTTGTAGCAGCTATTCCCGCCTCATCAGCCAGCCCTGCGGCAGTTCCC
GTCGAGCCCCGCCCTTTTCTACCTATCCCCTTCTCCAGCCCCTTCCCGCCCAATTCACGG
CCCCACCCCTGACCTTTCTCGCCCGG
gtgggcatcacccccgtctcgccagcaccccttcgacttctctgacctcatctcctttct
ctatagctcgggttcatgacgctctcgatattcctgtgcagaaacctggaccacgtctac
aaccggctcgctcgataccgttaggccccgccctccccaaagtcccgccccgcccccgtc

 1.11 Term +   5974   6051   78  0  0  122   47   109 0.921   8.87
ctcatcagccagccctgcggcagttcccgtcgagccccgcccttttctacctatcccctt
ctccagccccttcccgcccaattcacggccccacccctgacctttctcgcccgggtgggc
atcacccccgtctcgccagcaccccttcgacttctctgacctcatctcctttctctatag
CTCGGGTTCATGACGCTCTCGATATTCCTGTGCAGAAACCTGGACCACGTCTACAACCGG
CTCGCTCGATACCGTTAG
gccccgccctccccaaagtcccgccccgcccccgtcacgtgcgctgggcacttccctgct
gcctgtaaatatttgtttaatccccagttcgcctggagccctccgccttcacattcccct
ggggacccacgtggctgcgtgcccctgctgctgtcacctctcccacgggacctggggctt

 2.02 PlyA -   6503   6498    6                              -4.03
 2.01 Term -   7160   7047  114  2  0   94   49   135 0.988   9.70

Predicted peptide sequence(s):


>CD37_1|GENSCAN_predicted_peptide_1|444_aa
METWEGLPHESLVPTNSKAPQVKMSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWIL
IDKTSFVSFVGRFKEPSQCHRTSDRAETTGDEEELKEEGEGLAFVPLQIWSKVLAISGIF
TMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTI
QKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSAT
NDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREMTVMVLSVQLQRRALRRKC
EPHVPGAGDSSPGPSLIADGGGGHSGSLWGGWGMAGACPNWGDKAPQGKLPMALGLWPLW
VQDEDQPDTGTSTPTCSSYSRLISQPCGSSRRAPPFSTYPLLQPLPAQFTAPPLTFLARL
GFMTLSIFLCRNLDHVYNRLARYR

>CD37_1|GENSCAN_predicted_peptide_2|37_aa
VVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRD