GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:39:05

Sequence CD22_1 : 20550 bp : 52.87% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1070   1222  153  1  0  106   98    75 0.789  11.08
gagtcattcgcatttcctgagagctgggtagagggggagttgtggaggagcccattctga
aactgatctgatattgcaaacccatacacggaaaggaagaactgcccatacgtattcgag
tcttccaatctgactccgagcccgcatccccctcaatcgtctcttttccccactccccag
ATCACGGTGCTGCTTGGTCCCCCTCAGAGCCATAGAGAAGCAGGGGGTGTGGCCATGGAG
GGGAAACCTCTGTCACCAGAGACTTTACTGTACTTCTCCTTTTGCTCTCAGATGCTGCCA
GGGTCCCTGAAGAGGGAAGACACGCGGAAACAG
gtaaaaatcattttgcttttattttgcattcaacaagcaagttattacggaacagcagtt
atgggccaggcatacctcccagagctgggaacacagtggggacctccctggctctctctt
accggtgttacaacaggttgtagacagacccctgtcttgagcatcctccttgccaggcct

 1.02 Intr +   2470   2652  183  0  0   45  109   101 0.838   8.40
tgcacttcagcctgggcgacagaagaatgagactctgtctcaaaagaaaaaaaaagaatc
ttacttaactcttttaccctgcctttctcaagtgtatgtgaccttgaagatgttttttgc
atgtgacatgatgagtacctgcggggctgatgtcagctctgcctggggaatctgcctcag
CTTCAGACCCTGCACCCCAAATTCATGCTTAGCCCAGGCCAGACCCCCTTCCTGCTGTCG
GCAAGCAGCTTAGCTTTCCGCACACCCATGAACAGATACCCAGCAGCCTTTGGCATGAGC
CATGTGGCCCGAGGAGATAAACAGACAGAGAGAGGAACATTGATGCGTGTGAAATGTTGG
CAG
gtgagtgggaggggcttgggttggtgctgagaccggagacacactctgctgtcacatcct
tcagggtccccgggggccagcacggagggccatgatcatgtaaattgggacttaaattta
actctatgtaaatataactctatgcagaggtcagggatggtagaggacaagctcactgca

 1.03 Intr +   4011   4066   56  2  2   68   82     5 0.252  -3.83
tctgtctcaaaaaaaaagaaagaactccgtgagcatcccaaatgccacatccccataatg
caaccagacccggtcctcccggatccaggggaagggtcggagctcagtgggtgagcaaga
aaagccacgtggaagaagtaagcggccagatggctcaaagacaaactctcccctgctcag
GCTTGCACCCAGACACGACACCATGCATCTCCTCGGCCCCTGGCTCCTGCTCCTGG
gtaaggactgtggcctgggctagtactggggttctgggatgtcagtgggcactggaggag
gaggaaagacccaggcagagaggcgtcaacatagggtagggtgggggcagcggtgtgtat
agataaatgtacatacaaatatatatgtttcccatatatacatacacttctctcattgca

 1.04 Intr +   4645   4916  272  1  2   66   95   245 0.165  20.72
tttaaaataaaaaataacttttaaaagaaggctctcatgcccccttagtaatgctttctg
atcactgtggtgagttctagaatacttggctttctctgactcaagtaaatgggtttttga
gcaccctgaaaccctctacgcctgggagggggcctgcgtctggatcccctgcacctacag
AGCCCTAGATGGTGACCTGGAAAGCTTCATCCTGTTCCACAATCCTGAGTATAACAAGAA
CACCTCGAAGTTTGATGGGACAAGACTCTATGAAAGCACAAAGGATGGGAAGGTTCCTTC
TGAGCAGAAAAGGGTGCAATTCCTGGGAGACAAGAATAAGAACTGCACACTGAGTATCCA
CCCGGTGCACCTCAATGACAGTGGTCAGCTGGGGCTGAGGATGGAGTCCAAGACTGAGAA
ATGGATGGAACGAATACACCTCAATGTCTCTG
gtaaggccttcggggagcgggtcctctgctctgggcaggggtgagtgggaggcaggaaat
acctgactcctggcacagagctcacaaaccgagcttcctgcagagctcaggcaggggacg
ccagcggatgacgatggcgatgcagcagcactagacagagctgcgggacctcggatgtcc

 1.05 Intr +   8028   8333  306  1  0  108   75   221 0.831  19.77
aaaaaacaacaacacaacaacaacaacaataacaacaaaaaaacaaagcaggactggaga
gaggtggaatgaagtggcaaggggttcctgaggggtgatttgggacaggacatctaaagc
caggtgtacgctcacgtcctcagtcccccaggctcctgcacgggctctgttcttttgcag
AAAGGCCTTTTCCACCTCATATCCAGCTCCCTCCAGAAATTCAAGAGTCCCAGGAAGTCA
CTCTGACCTGCTTGCTGAATTTCTCCTGCTATGGGTATCCGATCCAATTGCAGTGGCTCC
TAGAGGGGGTTCCAATGAGGCAGGCTGCTGTCACCTCGACCTCCTTGACCATCAAGTCTG
TCTTCACCCGGAGCGAGCTCAAGTTCTCCCCACAGTGGAGTCACCATGGGAAGATTGTGA
CCTGCCAGCTTCAGGATGCAGATGGGAAGTTCCTCTCCAATGACACGGTGCAGCTGAACG
TGAAGC
gtgagtctccccggcatgcctgtgggaagggcaaggtctgtgtcaccttctccccagccc
cgcagggggcatgcacccagggcagggggaagcctgcacagacggcggcatcctccagcc
ctggtcacgccgccttgtcagccctggtgtttcgggaaaaagatttgctctagcctaaca

 1.06 Intr +   9747  10013  267  1  0  106   39   390 0.803  33.94
ggagaccaagaagtagaggaagtgggagggggaagctgagagccgagttaggaggctgtg
accatcacctgggtgaagggactggcaggccatggctttgtcagaataaaagcactttcc
acaccctccaccctctgaggattccccgccccctccccgactgcccctctgctcctccag
ACACCCCGAAGTTGGAGATCAAGGTCACTCCCAGTGATGCCATAGTGAGGGAGGGGGACT
CTGTGACCATGACCTGCGAGGTCAGCAGCAGCAACCCGGAGTACACGACGGTATCCTGGC
TCAAGGATGGGACCTCGCTGAAGAAGCAGAATACATTCACGCTAAACCTGCGCGAAGTGA
CCAAGGACCAGAGTGGGAAGTACTGCTGTCAGGTCTCCAATGACGTGGGCCCGGGAAGGT
CGGAAGAAGTGTTCCTGCAAGTGCAGT
gtgagcccctcggagctggggacaggccaggcagggaggtagcaggggtggacccggaga
ggggagccacgggggctctcggggccgtgtgcacaggttgggggtgctctcctcacccct
ccactcgcctctgccccctcttccagatgccccggaaccttccacggttcagatcctcca

 1.07 Intr +  10160  10423  264  0  0  113   65    78 0.912   6.02
ggaaggtcggaagaagtgttcctgcaagtgcagtgtgagcccctcggagctggggacagg
ccaggcagggaggtagcaggggtggacccggagaggggagccacgggggctctcggggcc
gtgtgcacaggttgggggtgctctcctcacccctccactcgcctctgccccctcttccag
ATGCCCCGGAACCTTCCACGGTTCAGATCCTCCACTCACCGGCTGTGGAGGGAAGTCAAG
TCGAGTTTCTTTGCATGTCACTGGCCAATCCTCTTCCAACAAATTACACGTGGTACCACA
ATGGGAAAGAAATGCAGGGAAGGACAGAGGAGAAAGTCCACATCCCAAAGATCCTCCCCT
GGCACGCTGGGACTTATTCCTGTGTGGCAGAAAACATTCTTGGTACTGGACAGAGGGGCC
CGGGAGCTGAGCTGGATGTCCAGT
gtgagtagccacggagcctctggttctagggagagaagatggacacagggaacggggaag
gcagatggggtgcagggcattccggggtcctggagtcaagagcaaggagcagccagggtc
tcctgttcacaactgctgtctcagctcctagcatagggcctggctcatggagggtgcttg

 1.08 Intr +  12873  13130  258  1  0  100   65   138 0.972  10.67
gagagccagggcagggtttctgttctcacacagatgcaggaaggacgcacaagcccccct
ttgattaatttaggacctgtgcagatgcccgggacaggtagcgggagaagaggaagcagg
agggaaggggtactgtggacagctggcttttctttactcacctctctggttttcttccag
ATCCTCCCAAGAAGGTGACCACAGTGATTCAAAACCCCATGCCGATTCGAGAAGGAGACA
CAGTGACCCTTTCCTGTAACTACAATTCCAGTAACCCCAGTGTTACCCGGTATGAATGGA
AACCCCATGGCGCCTGGGAGGAGCCATCGCTTGGGGTGCTGAAGATCCAAAACGTTGGCT
GGGACAACACAACCATCGCCTGCGCAGCTTGTAATAGTTGGTGCTCGTGGGCCTCCCCTG
TCGCCCTGAATGTCCAGT
gtgagtccctgggctaggcagggggatctgggaggtggcccggctgggatgaggggatga
aggcaacgaggccggagcctgggccagtgtcttcaacagaattgagggacaggagcctgg
cgtcagggccaaggggaggggaggcctggggacagcaaaagggacagggagcggagaggt

 1.09 Intr +  13335  13598  264  1  0   49   56   162 0.960   7.12
gatctgggaggtggcccggctgggatgaggggatgaaggcaacgaggccggagcctgggc
cagtgtcttcaacagaattgagggacaggagcctggcgtcagggccaaggggaggggagg
cctggggacagcaaaagggacagggagcggagaggtcagcttgggacccttgccctccag
ATGCCCCCCGAGACGTGAGGGTCCGGAAAATCAAGCCCCTTTCCGAGATTCACTCTGGAA
ACTCGGTCAGCCTCCAATGTGACTTCTCAAGCAGCCACCCCAAAGAAGTCCAGTTCTTCT
GGGAGAAAAATGGCAGGCTTCTGGGGAAAGAAAGCCAGCTGAATTTTGACTCCATCTCCC
CAGAAGATGCTGGGAGTTACAGCTGCTGGGTGAACAACTCCATAGGACAGACAGCGTCCA
AGGCCTGGACACTTGAAGTGCTGT
gtgagtgagggccggaggctgggagtggagcagagaagggaccagtggcctgcctggtag
tgacttcgcaccccctccccctgcccgccatgcagatgcacccaggaggctgcgtgtgtc
catgagcccgggggaccaagtgatggaggggaagagtgcaaccctgacctgtgagagcga

 1.10 Intr +  13694  13957  264  0  0   81   65   206 0.998  15.62
ccagaagatgctgggagttacagctgctgggtgaacaactccataggacagacagcgtcc
aaggcctggacacttgaagtgctgtgtgagtgagggccggaggctgggagtggagcagag
aagggaccagtggcctgcctggtagtgacttcgcaccccctccccctgcccgccatgcag
ATGCACCCAGGAGGCTGCGTGTGTCCATGAGCCCGGGGGACCAAGTGATGGAGGGGAAGA
GTGCAACCCTGACCTGTGAGAGCGACGCCAACCCTCCCGTCTCCCACTACACCTGGTTTG
ACTGGAATAACCAAAGCCTCCCCTACCACAGCCAGAAGCTGAGATTGGAGCCGGTGAAGG
TCCAGCACTCGGGTGCCTACTGGTGCCAGGGGACCAACAGTGTGGGCAAGGGCCGTTCGC
CTCTCAGCACCCTCACCGTCTACT
gtaaggcctcttcctgctcttgttcttcttggtggtggtcagtccttccttccttccttc
cttccttccttccttccttccttccttcctttctttctctctttcttttcctcctcctct
tcttcccctcctcctcctcttcctccttcttcttcttcttctgctttctccctctcctcc

 1.11 Intr +  16821  16917   97  1  1  107  101   115 0.999  14.27
ctaaagggaggcccagagcaagcaggggccgttgtcaccctcttcctctgcacccctgca
cgcatgcaggggagaaggacgagtctggctgcagagagaagtccaggatgccttccaggc
aaaggctgccagggagagctggcccctcagttgattaaggtctctcctttctccacccag
ATAGCCCGGAGACCATCGGCAGGCGAGTGGCTGTGGGACTCGGGTCCTGCCTCGCCATCC
TCATCCTGGCAATCTGTGGGCTCAAGCTCCAGCGACG
gtgagctcctgccatcccccaccacctcctctatcccttggcagaggcccgtgtccagtt
gctccatctcgaagcctccagcctgtggagtccctgaccctcacacatgtgcctttattt
ctcagttggaagaggacacagagccagcaggggcttcaggagaattccagcggccagagc

 1.12 Intr +  17043  17118   76  0  1   99   97    21 0.807   4.11
ggtcctgcctcgccatcctcatcctggcaatctgtgggctcaagctccagcgacggtgag
ctcctgccatcccccaccacctcctctatcccttggcagaggcccgtgtccagttgctcc
atctcgaagcctccagcctgtggagtccctgaccctcacacatgtgcctttatttctcag
TTGGAAGAGGACACAGAGCCAGCAGGGGCTTCAGGAGAATTCCAGCGGCCAGAGCTTCTT
TGTGAGGAATAAAAAG
gtaggatggggctgggcacgatggctcatgcctgtaatcccagcactttgggaggctgag
gcaggtggatcacctgaggtcaggagttcgagaccagcgtagccaacatggtgaaaccct
gtctctacaaaaaatattttaaaaattagccgggcgtgatggtccatgcctgtaattcca

 1.13 Intr +  17594  17712  119  1  2  112   19    53 0.962   0.57
aaaaaaaaaaaaaaaaaaaaaaaagggtaggcatgaggcagactgtgaagctgagtgggg
aaacaaggtgaaggaaggggataaaatgtcctctgaggagacctgggctgtcagaggcca
gggaaggggacgagggttggggaacaggtggttagcacttcatcctcgtctccctcccag
GTTAGAAGGGCCCCCCTCTCTGAAGGCCCCCACTCCCTGGGATGCTACAATCCAATGATG
GAAGATGGCATTAGCTACACCACCCTGCGCTTTCCCGAGATGAACATACCACGAACTGG
gtactgagggtaccaggagggtgaccctgcaccctgggagggaggcgggaggaaaagctc
tgtcccgcctgccctctttgtgccaggcccatgccaggcaccctgatacatgctctgcct
cattcccactcggcaacaagcctctgggtaagggccagtctccagaagtggacctgctcc

 1.14 Intr +  18143  18227   85  2  1   77   79   109 0.988   9.22
gcctactccctccacgcacatttgcacgagctcctactgtgagctttgggcactggggag
gccacaggttttacataaggggctgaggttggggtgctgttgggggctctgggtgttgag
agggaggagagttcgtgggagatgcttcatgcgtggtcgtctatctgccctgtctctcag
AGATGCAGAGTCCTCAGAGATGCAGAGACCTCCCCCGGACTGCGATGACACGGTCACTTA
TTCAGCATTGCACAAGCGCCAAGTG
gtaaggagggtctccccaggtctccccagaggggctgtggaaggctggggacagggcctg
gcctcagtggtgggtcccacataggaaggagttgggtaggcatccgtggtggcagaggtt
gggtgttggagacggttgctccggcagagctggccagagccaggcaggtacctccaggtc

 1.15 Term +  18375  18689  315  2  0   41   47   292 0.981  15.69
gtcacttattcagcattgcacaagcgccaagtggtaaggagggtctccccaggtctcccc
agaggggctgtggaaggctggggacagggcctggcctcagtggtgggtcccacataggaa
ggagttgggtaggcatccgtggtggcagaggttgggtgttggagacggttgctccggcag
AGCTGGCCAGAGCCAGGCAGGTACCTCCAGGTCCTGGATGCCGGCCACAGCCAGTTTCCT
GACACGAGGACACCCGCCTGGGCTTTTGGACCCCCGGGTGGAATGAAGGAGAGAATGCGG
AGAAAAGCGGCGGTGGAGGCTGGCGACAGTGGGGCCAGGCTAACCACCATGCGGTTTTCT
CAGGGCGACTATGAGAACGTCATTCCAGATTTTCCAGAAGATGAGGGGATTCATTACTCA
GAGCTGATCCAGTTTGGGGTCGGGGAGCGGCCTCAGGCACAAGAAAATGTGGACTATGTG
ATCCTCAAACATTGA
cactggatgggctgcagcagaggcactgggggcagcgggggccagggaagtccccgagtt
tccccagacaccgccacatggcttcctcctgcgcgcatgtgcgcacacacacacacacac
gcacacacacacacacacactcactgcggagaaccttgtgcctggctcagagccagtctt

Predicted peptide sequence(s):


>CD22_1|GENSCAN_predicted_peptide_1|992_aa
ITVLLGPPQSHREAGGVAMEGKPLSPETLLYFSFCSQMLPGSLKREDTRKQLQTLHPKFM
LSPGQTPFLLSASSLAFRTPMNRYPAAFGMSHVARGDKQTERGTLMRVKCWQACTQTRHH
ASPRPLAPAPGALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLG
DKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQE
VTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKI
VTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTT
VSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTV
QILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSC
VAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEW
KPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPL
SEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNS
IGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQS
LPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCL
AILILAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMM
EDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVSWPEPGRYLQVL
DAGHSQFPDTRTPAWAFGPPGGMKERMRRKAAVEAGDSGARLTTMRFSQGDYENVIPDFP
EDEGIHYSELIQFGVGERPQAQENVDYVILKH