GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:10:15

Sequence CALR_1 : 8280 bp : 53.27% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1272   1362   91  2  1   93   82   282 0.999  26.71
ggccatgggcatagaccaatgacaaagtggcaggggcgggcccaagggctgggtcaggtt
ggtttgagaggcgggtgggtataaaagtgcaaggcgggcggcggcgtccgtccgtactgc
agagccgctgccggagggtcgttttaaagggcccgcgcgttgccgccccctcggcccgcc
ATGCTGCTATCCGTGCCGCTGCTGCTCGGCCTCCTCGGCCTGGCCGTCGCCGAGCCTGCC
GTCTACTTCAAGGAGCAGTTTCTGGACGGAG
gtaacgcctggtcccgcctcgaggccgccccgacgacgcggccggcccccgatcctggat
ctgcgttgtcgcccgtaattaccgtttagaggtccaacacggtggcctcccgggactaga
gccgcgggcgatttctcttctgcgtccctggggagcgcggagggcgtagcggcctcccgc

 1.02 Intr +   1726   1827  102  2  0   71  116   144 0.999  16.15
gggagttagggttagcccgaggatctctgaaggcacccgacgtgtcaaactagaggttgg
aatggggagtgtcggggatctcctttcctgtccccagcagcttgtggctctcggcagatg
tttggtgtggggggggattagcacagccgctctgacctacccctctaatcccccacttag
ACGGGTGGACTTCCCGCTGGATCGAATCCAAACACAAGTCAGATTTTGGCAAATTCGTTC
TCAGTTCCGGCAAGTTCTACGGTGACGAGGAGAAAGATAAAG
gtaagagcctaggagtgggtgctcagatccgggaggacttcctggcagaagtccttgtct
gtacacacacagccgggacagtccccttggaggaggacaggtggaggaagtgggggagtc
ttctctattctctaagtcgagggtcctcgcgagtcaaggcccaacggtgacctcactacc

 1.03 Intr +   2020   2223  204  2  0   94   73   329 0.951  31.70
gagtgggtgctcagatccgggaggacttcctggcagaagtccttgtctgtacacacacag
ccgggacagtccccttggaggaggacaggtggaggaagtgggggagtcttctctattctc
taagtcgagggtcctcgcgagtcaaggcccaacggtgacctcactaccgtcccgtctcag
GTTTGCAGACAAGCCAGGATGCACGCTTTTATGCTCTGTCGGCCAGTTTCGAGCCTTTCA
GCAACAAAGGCCAGACGCTGGTGGTGCAGTTCACGGTGAAACATGAGCAGAACATCGACT
GTGGGGGCGGCTATGTGAAGCTGTTTCCTAATAGTTTGGACCAGACAGACATGCACGGAG
ACTCAGAATACAACATCATGTTTG
gtgagggcctgcttcctggtgctgatctctgtcccattagttagagggagacccagaccc
cattgactttcttaataatgattttttttggaaggggagctaaaagaataagtcccagca
acaatttattgcattatgatcgcagatctaggctgttaatttaatttgcgtgtttgtata

 1.04 Intr +   2645   2739   95  0  2   99   75   244 0.983  24.38
tctcctttaaacttaaggctccacccacagcccattcaggacagaatcagggtctgagtt
tctcttctcagccttgacagacccgagttgaagaaccaggtcttccttttataaagaggg
gtgagagcctcgagatgatgggtagtctctgactcttaactggatctgcttcacacctag
GTCCCGACATCTGTGGCCCTGGCACCAAGAAGGTTCATGTCATCTTCAACTACAAGGGCA
AGAACGTGCTGATCAACAAGGACATCCGTTGCAAG
gtgtgcctgggggtggtggcaaatggctgtcatggggagattcagaggtcagcctcattg
gggggtggcccccgctcaccttcttccttcttcaggatgatgagtttacacacctgtaca
cactgattgtgcggccagacaacacctatgaggtgaagattgacaacagccaggtggagt

 1.05 Intr +   2835   3044  210  2  0  118   73   301 0.999  31.23
ctgtggccctggcaccaagaaggttcatgtcatcttcaactacaagggcaagaacgtgct
gatcaacaaggacatccgttgcaaggtgtgcctgggggtggtggcaaatggctgtcatgg
ggagattcagaggtcagcctcattggggggtggcccccgctcaccttcttccttcttcag
GATGATGAGTTTACACACCTGTACACACTGATTGTGCGGCCAGACAACACCTATGAGGTG
AAGATTGACAACAGCCAGGTGGAGTCCGGCTCCTTGGAAGACGATTGGGACTTCCTGCCA
CCCAAGAAGATAAAGGATCCTGATGCTTCAAAACCGGAAGACTGGGATGAGCGGGCCAAG
ATCGATGATCCCACAGACTCCAAGCCTGAG
gttggtgtttgggcaggggctctgctctccacattggagggtgtggaagacatctgggcc
aactctgatctcttcatctaccccccaggactgggacaagcccgagcatatccctgaccc
tgatgctaagaagcccgaggactgggatgaagagatggacggagagtgggaacccccagt

 1.06 Intr +   3133   3246  114  0  0  120  113   196 0.999  26.45
cacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggatgagcgggcca
agatcgatgatcccacagactccaagcctgaggttggtgtttgggcaggggctctgctct
ccacattggagggtgtggaagacatctgggccaactctgatctcttcatctaccccccag
GACTGGGACAAGCCCGAGCATATCCCTGACCCTGATGCTAAGAAGCCCGAGGACTGGGAT
GAAGAGATGGACGGAGAGTGGGAACCCCCAGTGATTCAGAACCCTGAGTACAAG
gtgagtttggggctctgagcagggctggggctcacagtggggagtgcaccaaccttactc
acccttcggtttccttctcccttctgcagggtgagtggaagccccggcagatcgacaacc
cagattacaagggcacttggatccacccagaaattgacaaccccgagtattctcccgatc

 1.07 Intr +   3336   3479  144  2  0  127   94   224 0.929  27.89
ccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagagtggga
acccccagtgattcagaaccctgagtacaaggtgagtttggggctctgagcagggctggg
gctcacagtggggagtgcaccaaccttactcacccttcggtttccttctcccttctgcag
GGTGAGTGGAAGCCCCGGCAGATCGACAACCCAGATTACAAGGGCACTTGGATCCACCCA
GAAATTGACAACCCCGAGTATTCTCCCGATCCCAGTATCTATGCCTATGATAACTTTGGC
GTGCTGGGCCTGGACCTCTGGCAG
gtgagacttggaggaaaaaggaggatccctggggtacctcaagtgcataagatcacccaa
gaggaaagggacagggtaggcaccccaggtgagtctgactcaaaaatggtacttcttgta
aacagtacttcctggtctgtccctgtgaagtcctcacagcaacccctttaaggttatact

 1.08 Intr +   6129   6221   93  2  0  120  100   164 0.998  21.46
ggcgtgatccacctcacctggcctctccatctttttaactgcagtgtcagcggtgttcct
tgtcttctctgcagatgcaggcagcagaatatagtggttataggaacacaggtggaaacc
ctgtccaaagcaagggctatcgggtatcacctctgaccatccttcccattcatcctccag
GTCAAGTCTGGCACCATCTTTGACAACTTCCTCATCACCAACGATGAGGCATACGCTGAG
GAGTTTGGCAACGAGACGTGGGGCGTAACAAAG
gtgaggcctggtcctggtcctgatgtcgggggcgggcagggctggcagggggcaaggccc
tgaggtgtgtgctctgcctgcaggcagcagagaaacaaatgaaggacaaacaggacgagg
agcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggaggaggcagagg

 1.09 Term +   6305   6505  201  1  0   71   44   546 0.999  46.21
ccaggtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgc
tgaggagtttggcaacgagacgtggggcgtaacaaaggtgaggcctggtcctggtcctga
tgtcgggggcgggcagggctggcagggggcaaggccctgaggtgtgtgctctgcctgcag
GCAGCAGAGAAACAAATGAAGGACAAACAGGACGAGGAGCAGAGGCTTAAGGAGGAGGAA
GAAGACAAGAAACGCAAAGAGGAGGAGGAGGCAGAGGACAAGGAGGATGATGAGGACAAA
GATGAGGATGAGGAGGATGAGGAGGACAAGGAGGAAGATGAGGAGGAAGATGTCCCCGGC
CAGGCCAAGGACGAGCTGTAG
agaggcctgcctccagggctggactgaggcctgagcgctcctgccgcagagctggccgcg
ccaaataatgtctctgtgagactcgagaactttcatttttttccaggctggttcggattt
ggggtggattttggttttgttcccctcctccactctcccccaccccctccccgccctttt

Predicted peptide sequence(s):


>CALR_1|GENSCAN_predicted_peptide_1|417_aa
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL