GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:56:23

Sequence CACNG6_1 : 22776 bp : 50.33% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1678   2121  444  2  0   98   83   661 0.085  59.97
gtttttcctctgggccccgtcttctttgccaagttcttgagggcaacctagaccctcctc
tgaaccccagaggcttccccagccctggggatcatttttctcttctgaaccccagaagca
atctcgactttcgcatttgagattccagacaggactcggctctccctctttcatacccag
GGGAAACTGAGTCCCTCACCCCCTTCAAGACCCCAGGCCGCTCCTCGCTCCCGCCCCTCG
AGGCCCTTCGCCGGCTCTGCCTCCTCCCCCTTCCCGACCCCACCGGCCATAAGATGATGT
GGTCCAACTTCTTCCTGCAAGAGGAGAACCGGCGGCGGGGGGCCGCGGGCCGGCGGCGGG
CGCACGGGCAGGGCAGGTCGGGGCTGACGCCCGAGCGCGAGGGGAAGGTGAAGCTGGCGC
TGCTGCTGGCCGCCGTGGGCGCCACGCTGGCGGTGCTGTCCGTGGGCACCGAGTTCTGGG
TGGAGCTCAACACCTACAAGGCCAACGGCAGCGCCGTGTGCGAAGCGGCCCACCTGGGGC
TGTGGAAGGCGTGCACCAAGCGGCTGTGGCAGGCGGACGTGCCCGTGGACAGGGACACCT
GCGGCCCCGCGGAGCTGCCCGGAG
gtgagcagccgccgccccgagcgcagggcttgcgtcccacggacagggagggagaggggc
ccgtgtccgaggagaaaacccgccccagggacaaaagcctgagcccggaggagacagctt
gcctcgcagtaagcgccagtgcccacttcgtcctctgctctcagaaactgctgagagata

 1.02 Intr +   7152   7226   75  1  0  121  100    46 0.706   8.59
cctagatggcagtgtggtcgcaggtggctttcacacctctgggcatcatttttctcctct
gtgtatcagggatgctgatgtccaagttttaggctcccgtgggctgttaactgtccagcc
ctgagcttacgcaagggacctcacatcctcatgtctgttttctctctcctgctcccacag
AAGCAAACTGCACCTATTTTAAATTCTTCACCACGGGGGAGAATGCACGCATCTTTCAGA
GAACCACAAAGAAAG
gtgagaacttttcaccccctgctgggtgacaggtgggggaaatgctgagcgtgctggagg
agttctagagagagttatcccctcctctgctttaccccagggcaggtctcgtgtctataa
tctgtggctgtcccctggggagtgctggcgggagagttaatgatggggacatggtgctct

 1.03 Intr +   8547   8684  138  1  0   87   94   121 0.803  13.04
ctttctgagtcttaattccttcaacagtgtaagtaaaatgttgggctggatgatactcta
cttgaaaattcttctctcgtcccgaatcttacatcttcctggttctgggttcctatgggt
gaatcctcctcattccctacatcccatgttctctgcttctttcctctctcctgctggcag
AGGTGAATCTGGCAGCTGCGGTGATAGCAGTGCTGGGCCTGGCAGTCATGGCCTTGGGGT
GCCTCTGTATCATCATGGTGCTCAGTAAAGGTGCAGAGTTCCTGCTCCGAGTTGGAGCCG
TCTGCTTTGGCCTCTCAG
gtgagggttcagagcctggaggctgaggacattgcatgctgggaggatctccaggcactg
ttgcatgctgggagatggggtctctatgcactgttgcacgctcagagatggaatctctat
gcactgttgcatgctgggagtagggtctccacacactgttgcatgctgggagtaggatct

 1.04 Term +  20864  21102  239  0  2  132   43   181 0.984  14.33
ttctttatctccagcttcccaaatgctgcctgctatatagtaggtgtttagtaagtattt
gttgagtgcacgcgtgggaaggtgccagggtgggcgggagggctgggagcggatggcgga
gatgttcagacacagctggggtcgcgggcgtctgactgcgagctgtcctctctcccgcag
GCCTGCTGCTCTTGGTGAGCCTGGAGGTGTTCCGGCATTCCGTGAGGGCCCTGCTGCAGA
GAGTCAGCCCGGAGCCTCCCCCGGCCCCACGCCTCACCTACGAGTACTCCTGGTCCCTGG
GCTGCGGCGTGGGGGCCGGCCTGATCCTGCTGTTGGGGGCCGGCTGCTTTCTGCTGCTCA
CACTGCCTTCCTGGCCCTGGGGGTCCCTCTGTCCCAAGCGGGGGCACCGGGCCACCTAG
agccacgcgtgagacttctctaagcaaccaccgagccctttgaccttctccattgtaccc
ccaagatctttttgccccatctcctagagaaactgtgttctccctgctcgggggcccatg
tttttttacacgcctgcctcctgtccccttatcctttctccctctgtaaatacgtttttc

Predicted peptide sequence(s):


>CACNG6_1|GENSCAN_predicted_peptide_1|298_aa
XETESLTPFKTPGRSSLPPLEALRRLCLLPLPDPTGHKMMWSNFFLQEENRRRGAAGRRR
AHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKANGSAVCEAAHLG
LWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLAAA
VIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQR
VSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT