GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:34:22

Sequence CA11_1 : 10381 bp : 55.87% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1565   1631   67  1  1   65  110   155 0.987  14.58
tgggtttgaagggcggatctcagtccctggctgctttggcatttggggaactgggactcc
ctgtggggaggagaggaaagctggaagtcctggagggacagggtcccagaaggaggggac
agaggagctgagagaggggggcagggcgttgggcaggggtccctcggaggcctcctgggg
ATGGGGGCTGCAGCTCGTCTGAGCGCCCCTCGAGCGCTGGTACTCTGGGCTGCACTGGGG
GCAGCAG
gtaagacctggggttcccgggaggagcccccgagggagggtggaggtggggatgccaagg
agagggattcaggctgctctcttcccagctcacatcggaccagcacctgaccccgaggac
tggtggagctacaaggataatctccagggaaacttcgtgccaggtgccgccaaggcgggg

 1.02 Intr +   2628   2770  143  1  2   90  116    79 0.997  11.48
tctaggacccagaattctggatctgagcccagtcctccctcagacccaggagtctaggtc
cctagcccctcctcccctgggatctgggagtccagaccacagcccactcagcagatacca
gccctgggatccagtctctatttctgactccttgtcctcctactccgaccccacccccag
GGCCTCCTTTCTGGGGCCTGGTGAATGCAGCGTGGAGTCTGTGTGCTGTGGGGAAGCGGC
AGAGCCCCGTGGATGTGGAGCTGAAGAGGGTTCTTTATGACCCCTTTCTGCCCCCATTAA
GGCTCAGCACTGGAGGAGAGAAG
gtaaggggcttggagggaggagctattgaacccactggggatgggcatgaatagaggctg
gggaatggggtgctgaggtaggagagcagccttgggggaggaggggacacccagtgggtg
gagaggaggctgcttacactgtaaaatggatcacccattcttcccatcccaagcatggtc

 1.03 Intr +   6917   7102  186  1  0  125   57   205 0.999  21.50
ggaggttgcggtgagccgagatcacgccactgcactccagcctgggcaacaagagcgaga
ctccgtttcaaaaaaaaaaaaaaaaaaaaaaaagactgttggaatcagaaaatgtaggcg
tgggaaacgagagataaaagatctctccctgccccctgacagctcccgcctctcccacag
CTCCGGGGAACCTTGTACAACACCGGCCGACATGTCTCCTTCCTGCCTGCACCCCGACCT
GTGGTCAATGTGTCTGGAGGTCCCCTCCTTTACAGCCACCGACTCAGTGAACTGCGGCTG
CTGTTTGGAGCTCGCGACGGAGCCGGCTCGGAACATCAGATCAACCACCAGGGCTTCTCT
GCTGAG
gtagtggccactgattgtttacccgccaccctccgccctgagtcaccccaattcctccca
cctcaccctcttagtgtctcaccccatcctcctccacagaactggcctcccaccctaagc
actaatcctcagcctgattcgggcccccaaagctggggtcatgctctcctccccttctgc

 1.04 Intr +   7314   7409   96  2  0   94   66   117 0.934  10.81
tccgccctgagtcaccccaattcctcccacctcaccctcttagtgtctcaccccatcctc
ctccacagaactggcctcccaccctaagcactaatcctcagcctgattcgggcccccaaa
gctggggtcatgctctcctccccttctgctgggggaccccatgctctgtgctacccccag
GTGCAGCTCATTCACTTCAACCAGGAACTCTACGGGAATTTCAGCGCTGCCTCCCGCGGC
CCCAATGGCCTGGCCATTCTCAGCCTCTTTGTCAAC
gtgagcggaggcgagattcagagggagggagcagttgggtgcctggaacccggggtctga
gggaagcggggtgctgggaggcccagactcctgggtcctgggggaggagaaggttgaggg
cttggacttctgggctcctgtgtcctcacctcgtacccccacacaggttgccagtacctc

 1.05 Intr +   7576   7648   73  0  1   96   89    96 0.999   9.97
gcctctttgtcaacgtgagcggaggcgagattcagagggagggagcagttgggtgcctgg
aacccggggtctgagggaagcggggtgctgggaggcccagactcctgggtcctgggggag
gagaaggttgagggcttggacttctgggctcctgtgtcctcacctcgtacccccacacag
GTTGCCAGTACCTCTAACCCATTCCTCAGTCGCCTCCTTAACCGCGACACCATCACTCGC
ATCTCCTACAAGA
gtaagtccctggcgtgctgggggcagtggtcacacacgagggggttcaagagtgccatcc
ctctttactctggcctgatattcccgcagatgatgcctactttcttcaagacctgagcct
ggagctcctgttccctgaatccttcggcttcatcacctatcagggctctctcagcacccc

 1.06 Intr +   7738   7892  155  2  2   86   60   196 0.982  16.90
cctcgtacccccacacaggttgccagtacctctaacccattcctcagtcgcctccttaac
cgcgacaccatcactcgcatctcctacaagagtaagtccctggcgtgctgggggcagtgg
tcacacacgagggggttcaagagtgccatccctctttactctggcctgatattcccgcag
ATGATGCCTACTTTCTTCAAGACCTGAGCCTGGAGCTCCTGTTCCCTGAATCCTTCGGCT
TCATCACCTATCAGGGCTCTCTCAGCACCCCGCCCTGCTCCGAGACTGTCACCTGGATCC
TCATTGACCGGGCCCTCAATATCACCTCCCTTCAG
gtgaccctctgtccgcaccgcccttcctaggcctgggtactccactcactggcctgggca
tccccttgctcacctgccctccctctcctcatagactgaactcaagtaggtaagagggtc
agaccaccttgggggtgggtggggctgagaacagaccccgcccacctgctcccaggggcg

 1.07 Intr +   8144   8309  166  1  1  111   56   148 0.856  13.95
acctgccctccctctcctcatagactgaactcaagtaggtaagagggtcagaccaccttg
ggggtgggtggggctgagaacagaccccgcccacctgctcccaggggcggggtttcctgc
gtgacgtcaccaagaccattcactattcactcccagtttcccaccctccttccactgcag
ATGCACTCCCTGAGACTCCTGAGCCAGAATCCTCCATCTCAGATCTTCCAGAGCCTCAGC
GGTAACAGCCGGCCCCTGCAGCCCTTGGCCCACAGGGCACTGAGGGGCAACAGGGACCCC
CGGCACCCCGAGAGGCGCTGCCGAGGCCCCAACTACCGCCTGCATG
gtatggtccagtctgcaccccctctaagtcttgggctaaccctcttatatgtgtctcccc
ttggtgtctcagtgtgattcagtcccatcctccttcctgcgtctatatggtctagcctcg
tgagctgtctctttttctctctttccctacatgtctatgtggtacagtccacctgccagc

 1.08 Term +   9053   9078   26  0  2  100   53    -3 0.278  -3.93
tcccccctcctattggcttcttgtggttcagcccagtgcttctcgacctagtacattctg
gttccccgctcgcagacttccgacggtagggcccagcgcggcgcagcccacgccccctgc
acaccccccgccccttccatcctatactgacgccccctgccgttgttctctgtcttacag
TGGATGGTGTCCCCCATGGTCGCTGA
gactccccttcgaggattgcacccgcccgtcctaagcctccccacaaggcgaggggagtt
acccctaaaacaaagctattaaagggacagaatacttcctgttttctcagtggtctgatt
ctaggcgcggtggggaaacatttgggtattaaagaacagacttcttccggaaaccaatct

 2.01 Init +  10203  10341  139  2  1   83   68   170 0.983  12.77
gaggacctcaaatccccgtcgctcctaggatttgcagcgttctggatactggagggttgc
aggctacactcgcccgcccctgggcagacactcgtccaaaccactggagtgtgctggtga
ctggcaggccagcccttcgcctctccatgaacccgtgagcctgggggcaggtgccaggcg
ATGGCGCGGCCTGTGAGCGACAGGACCCCGGCCCCTCTGCTGCTGGGCGGCCCGGCCGGG
ACACCCCCTGGCGGGGGAGCGCTGCTTGGGTTGCGGAGCCTTCTGCAGGGGACCAGCAAG
CCCAAAGAGCCGGCCAGCT
gtgagttctaacccccatctcacccacttcggacaccctat
Predicted peptide sequence(s):


>CA11_1|GENSCAN_predicted_peptide_1|303_aa
MGAAARLSAPRALVLWAALGAAGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLP
PLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGS
EHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRD
TITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQ
MHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVP
HGR

>CA11_1|GENSCAN_predicted_peptide_2|47_aa
MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASX