GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:18:06

Sequence BRD4_1 : 45361 bp : 53.98% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   8519   8837  319  2  1  100   76   273 0.718  23.81
ttggggagaggagacattggaaccctttcagtcaaagcatggggtggtccctctggccaa
cttggctagctaccgccagggaactcagtccttggagaccacagccagagggacttgtca
ttctgagcggtgcccatctgctgactgatatctcacgggggctcttctcttcctttgtag
AGTGCCTGGTGAAGAATGTGATGGGATCACTAGCATGTCTGCGGAGAGCGGCCCTGGGAC
GAGATTGAGAAATCTGCCAGTAATGGGGGATGGACTAGAAACTTCCCAAATGTCTACAAC
ACAGGCCCAGGCCCAACCCCAGCCAGCCAACGCAGCCAGCACCAACCCCCCGCCCCCAGA
GACCTCCAACCCTAACAAGCCCAAGAGGCAGACCAACCAACTGCAATACCTGCTCAGAGT
GGTGCTCAAGACACTATGGAAACACCAGTTTGCATGGCCTTTCCAGCAGCCTGTGGATGC
CGTCAAGCTGAACCTCCCT
gtgagtagtgtgggcagggcccagggtggccgtcctggaggtcgtctcctgcatgtctcc
tggtcagggcagttcctggggggagggtaggagatgcatttggaatcatggtgagagctg
cagggcccttgagtgagtggtttcagcagttctgatcagttgaaatcagggagaaagaat

 1.02 Intr +  11278  11323   46  0  1   46   77    34 0.384  -3.43
actgtggccaattcagtggcctttggccatagaataaaatttaaatttccactgggatag
atctattcagacttggttctcttgggaaaggaggtcagagcatagaaagtggcaccgata
gtctgcttccagtctcccctcttgaccacttgcctaaggtgcctgggtgtgcacttgtag
CCCTCACCCCCAGGGCAGTTCCATGAGCTGTGCCAAAACCTTACAT
gtaagcaggtggcccttgactctttctcgtggatgtcagaacatctcaaaaaccccacac
ccataccctgtgctggcctttccaacgctgtccactaccatcccgagcagggcctcagtg
cttgctgttagtatacctgctctcttctccctgcaacagcctctccacctgcagcctgtg

 1.03 Intr +  12460  12521   62  2  2   78   60   100 0.854   5.14
ccttatttattaaaagtgaaagaatattttagtatccataaaaagaaaaaatgtgcattt
caatgaaggcagcctatttcaagatagagtggttggaaacttgtacgtttccctctgaat
tactccccagcatccaggaacccttccccgctccactttattttggtgttccccctcaag
ATCACTTGCTGATGCCAGTAGGAGCTGTGGCTCCCGTGGATTTACCTGTGGAGCAGCCAG
GG
gtgaggtccccaggccagcctggccagcccagcgtttgtgctgcctggctgcctaggtga
cactggacttttgctctctgctctccaggattactataagatcattaaaacgcctatgga
tatgggaacaataaagaagcgcttggaaaacaactattactggaatgctcaggaatgtat

 1.04 Intr +  12610  12747  138  0  0  104  100   141 0.998  18.07
ctccactttattttggtgttccccctcaagatcacttgctgatgccagtaggagctgtgg
ctcccgtggatttacctgtggagcagccaggggtgaggtccccaggccagcctggccagc
ccagcgtttgtgctgcctggctgcctaggtgacactggacttttgctctctgctctccag
GATTACTATAAGATCATTAAAACGCCTATGGATATGGGAACAATAAAGAAGCGCTTGGAA
AACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAAT
TGTTACATCTACAACAAG
gtgagatgtaggggtgggtgtccagctgccctggggagagaggaggggaggcgacggcag
tgggcatgtcaggagcccgtgggcaggggtgttgggtgtggctgggcttggagtctggca
agaggagacccttggaggtagaggtaatgagacctgtggttgttcctgtgactgggtgtg

 1.05 Intr +  14101  14236  136  0  1  100   80    15 0.839   2.55
caagcctctgtgatacctggtagtgtagccattgtggctcctttgggtgcagatcgggga
aggacccggaatacgacgcttcatgttttgggggcagggggtgggtggcatggggtgccc
tgtctacagaggtggggaggggagggccctctgactctacccctgtgtctccttatccag
CCTGGAGATGACATAGTCTTAATGGCAGAAGCTCTGGAAAAGCTCTTCTTGCAAAAAATA
AATGAGCTACCCACAGAAGAAACCGAGATCATGATAGTCCAGGCAAAAGGAAGAGGACGT
GGGAGGAAAGAAACAG
gtagagtactgaaatagcaagtaaattggctttctccccgacctttgtcccttttccaag
tttggtggggggctgggagtggcaggaggatgtgacattatatactgcatgccgtgttgg
tgtttggacatgtgagattgggtttggtgttggatccatcccatagggtcatgtggccct

 1.06 Intr +  16009  16298  290  2  2   64  113   176 0.640  15.21
ttctttgagccccagggacaggtggaagggtttggcagagtggagtctgggatgttcgtc
tctcaggcaaatgcaacacgcgaatgtgcgttcactgtgtgtggtgtatgtccccacgag
gtcagccagcatgtggatgtcagcatggtctctaactcgccgtcttattatgatttgtag
GGACAGCAAAACCTGGCGTTTCCACGGTACCAAACACAACTCAAGCATCGACTCCTCCGC
AGACCCAGACCCCTCAGCCGAATCCTCCTCCTGTGCAGGCCACGCCTCACCCCTTCCCTG
CCGTCACCCCGGACCTCATCGTCCAGACCCCTGTCATGACAGTGGTGCCTCCCCAGCCAC
TGCAGACGCCCCCGCCAGTGCCCCCCCAGCCACAACCCCCACCCGCTCCAGCTCCCCAGC
CCGTACAGAGCCACCCACCCATCATCGCGGCCACCCCACAGCCTGTGAAG
gtgagtctcctggactctggagggctgcttcaccagggaggagagcggccctgtccttgc
ccgtgctttacacagagcctgtcctgggtcccgggcactggtgggtgtttctggggagat
cttgctgtgttgaaattgcagcccagaaacagccgccccactgactcaaaggtcccataa

 1.07 Intr +  16886  17280  395  1  2   90   86   652 0.667  59.22
gagcagagtggtgggacacgatctgcctgtccttggccctttgcctgtgcaattatcttt
gggtccattctgtgtgagcgatgggccccaagacagggcctggctttgggggtgaccctg
agggcagctgtgccggctgccacttctgactgtgcctgttggcgtccgtgttcttggcag
ACAAAGAAGGGAGTGAAGAGGAAAGCAGACACCACCACCCCCACCACCATTGACCCCATT
CACGAGCCACCCTCGCTGCCCCCGGAGCCCAAGACCACCAAGCTGGGCCAGCGGCGGGAG
AGCAGCCGGCCTGTGAAACCTCCAAAGAAGGACGTGCCCGACTCTCAGCAGCACCCAGCA
CCAGAGAAGAGCAGCAAGGTCTCGGAGCAGCTCAAGTGCTGCAGCGGCATCCTCAAGGAG
ATGTTTGCCAAGAAGCACGCCGCCTACGCCTGGCCCTTCTACAAGCCTGTGGACGTGGAG
GCACTGGGCCTACACGACTACTGTGACATCATCAAGCACCCCATGGACATGAGCACAATC
AAGGTTAGCGGGATGTGCCTGAGGGAAGGGACAAG
gtgggcaggctgtccctccacatcagaaccttcctagaccttttagtccaagaggaagcc
caggccctggaacggtggctgcgtggatttttcccgccaactcgaagaaactcagcgccc
cctgctgtctgctgtgggacgtgctctgagacctggtgcttggccattgtggctacagat

 1.08 Intr +  17484  17643  160  0  1   65   87    39 0.491   2.00
cagaaccttcctagaccttttagtccaagaggaagcccaggccctggaacggtggctgcg
tggatttttcccgccaactcgaagaaactcagcgccccctgctgtctgctgtgggacgtg
ctctgagacctggtgcttggccattgtggctacagatgcctgtgctgccccttcccctag
TCTGAGGAAAAGCAAGACAAGCCCTCTGGCCTTGGGGGCCCAGTGCCCCAGGTACCTTGC
CCACACAGTAGATGCTCCATGGGAGTTGGGGCTTGGCGGCCTTGCCAGCCTCTTTGTGGT
GGAGAAGGCCTTGCTGTCTCCTCTGTGTTGGAGGCACGCT
gtaagtgccgacattttcaccatagtgttttgaggcttttttagttttaagacttgttac
gtgtttcttcttctgggagtggagtcccaagcatggggcaggcagagcagggaacagtgc
tgtgtccctttgaccagctcctgtactgtgtcatcacgatgagctgggcccagccctctc

 1.09 Intr +  18104  18232  129  1  0   84   94   233 0.996  24.90
ccagtcccagccctgaggctgagaactggggtgatggcctgtccccccactagagtcttg
accaaactgagagccaagaaaccaacttgctcttctaggcatccctttcgtctgctgcca
gccacttctccatggtcacatgggcagacacagctaacagggacttgtcttgttttccag
TCTAAACTGGAGGCCCGTGAGTACCGTGATGCTCAGGAGTTTGGTGCTGACGTCCGATTG
ATGTTCTCCAACTGCTATAAGTACAACCCTCCTGACCATGAGGTGGTGGCCATGGCCCGC
AAGCTCCAG
gtgaggcttgggagggcgcagccaccctcagcagagcaggctgaggtcctcgtgggagca
gacttctgtgggccttggcagagtttttttttctgtcactttccttgggataatgccatg
ttgctttagaaaagtgcctaaagtcagcctagtgcatacattttaagttggggttattca

 1.10 Intr +  24479  24688  210  1  0   69   94   361 0.791  34.43
ttgtcagaggcccttggctggcccttgcccctgtctcggcagcaaagagacaggatcacc
atcctctttcgccctcggttgctttctgttgagttggccccagcagccaatgagggcagg
tgatgctaggccgcggcctgggtacccagcagccgtcacagcatgtctttccctcaccag
GATGTGTTCGAAATGCGCTTTGCCAAGATGCCGGACGAGCCTGAGGAGCCAGTGGTGGCC
GTGTCCTCCCCGGCAGTGCCCCCTCCCACCAAGGTTGTGGCCCCGCCCTCATCCAGCGAC
AGCAGCAGCGATAGCTCCTCGGACAGTGACAGTTCGACTGATGACTCTGAGGAGGAGCGA
GCCCAGCGGCTGGCTGAGCTCCAGGAGCAG
gtgagggcattggtggctccattcttaatccccagagtccgtggaccagggtggcctccc
cagaagtttctaagagatgttcttggttctgagttcccaagggagcataattcccactgg
accacctgtggccttttcccctttgctaggtcaaatgcatgttgatcatacacgtatgta

 1.11 Intr +  25389  25588  200  2  2   96   58   217 0.981  18.17
aatctggttaacatgacaggcgcaaagctgggggccttcccttcccctgcctcccctatg
cccacaccctgatgccccaggtgcatgctgtcgcatgttttttggagcagacgcctgggt
cttgggtgacaggaaggtggtttcagccctgagtgtgtgtcttgcctgtctggtctacag
CTCAAAGCCGTGCACGAGCAGCTTGCAGCCCTCTCTCAGCCCCAGCAGAACAAACCAAAG
AAAAAGGAGAAAGACAAGAAGGAAAAGAAAAAAGAAAAGCACAAAAGGAAAGAGGAAGTG
GAAGAGAATAAAAAAAGCAAAGCCAAGGAACCTCCTCCTAAAAAGACGAAGAAAAATAAT
AGCAGCAACAGCAATGTGAG
gtctgtgtcccctgaatttgtcctgggtggggaccctccttccagggcttgctctgagac
tgtgtgggccactgcccctccctgtcctcattgggtgcggaggctgcccctctgcagccg
tggcttcacaggccaggctggtggccacttgcacacaggacttagctgcactgtctctgc

 1.12 Intr +  26060  26355  296  2  2   76   75   570 0.980  51.70
gcttcggtctccactgggtgctcccagagattgagttgcccatgccccgtttcctgtgaa
ggctggtgggtggggggtatgggaagggcaccccttccccccaacatacatgtggaggaa
tgagtgcctggcttcctcagggggcccgttcttgatggtgtctgcatcgtcccttcgtag
CAAGAAGGAGCCAGCGCCCATGAAGAGCAAGCCCCCTCCCACGTATGAGTCGGAGGAAGA
GGACAAGTGCAAGCCTATGTCCTATGAGGAGAAGCGGCAGCTCAGCTTGGACATCAACAA
GCTCCCCGGCGAGAAGCTGGGCCGCGTGGTGCACATCATCCAGTCACGGGAGCCCTCCCT
GAAGAATTCCAACCCCGACGAGATTGAAATCGACTTTGAGACCCTGAAGCCGTCCACACT
GCGTGAGCTGGAGCGCTATGTCACCTCCTGTTTGCGGAAGAAAAGGAAACCTCAAG
gtgtgcttgggccccctgggcatggggttccttctgtgggcaccctcagagtaacttttc
cctccttgctcagtccactctttctgcgcccccccccttttttttttccaattataatat
ctgtgttcttgacacagaaacctccgaaaggttgtgacattgcactcacccctaggctgt

 1.13 Intr +  27390  27500  111  1  0   76   66   195 0.961  16.95
ggaactgtgggaccacgtgggttctgggagtggcagctggcagttgggagcagcccctgg
gcccaccgtgcacaggctcctcactggtccttcctccagatggatggggtgtgcccatgg
cttagagcggcttcctgggccacagccctgcctgaccagctcccattgcttggattgcag
CTGAGAAAGTTGATGTGATTGCCGGCTCCTCCAAGATGAAGGGCTTCTCGTCCTCAGAGT
CGGAGAGCTCCAGTGAGTCCAGCTCCTCTGACAGCGAAGACTCCGAAACAG
gttaggtgacttgtgttctacgtgtcttaccaaactcttcccacctgtgcctggcactag
ctcggtcctgtgtccaggatgctagagcccagagacggcactcccagaacttgctgggtt
cctctgtctgtctgtctctttgttaactgtctccctggggccatgaatagccctgcactc

 1.14 Term +  27869  28095  227  0  2   38   41   274 0.854  14.97
agtgtccattctctcggcctggccgttatgctctccctgccagggtctggtcatggagga
tgaatggccaagggcgttgacactgcggagccctggatggtgggcggggaagctgggcca
tgaggactgtgggcgtgggggtccaggctgtgctgttgaccttgatgtgaccacacccag
CTTTCTGCACCAGTGGAGACTTCGTGTCCCCAGGGCCTTCCCCGTATCACAGTCACGTGC
AGTGCGGCCGCTTCAGGGAGATGCTTCGCTGGTTTCTGGTGGATGTGGAGCAGACTGCAG
CTGGCCAGCCGCATCGCCAGTCTGCTGCTGGCCCTGCCATCACCTGGGCCCCAGCCATTG
CCTACCCCTCCCCAGAGTGTGCTCGTTGCTGTGTTGGCTGCTCCTGA
atctgccctaactccacacgcacctggacttgcgtgtccctcctgcagttctaactaaca
gtcccttcttttcaagccccgtgggtctgcacgttggaccctgggttccccattagagcc
caccttctgagcagcagcctcagtgggaggtggaggcaggtagtgatgctgggtgccagg

 2.01 Init +  35883  36048  166  2  1   72   64    70 0.400   1.87
cacagaagcttagcgtggccctccacgaagcagatccaagtggaaggagcctggatttgg
gcaaagcatgtgtcctccaacaccagcagcaagaggcagcaccctgacaaggagctcagg
cgaagccaggcagtgccatgaggtgcttctcagtgacaggaatccaaaaggcgccatacc
ATGGGCCCGGCCTCCCATCTGGTGGCAGGCGACTGTGACCTGCCAGCCCATGAGCACTGG
CCAGGGCTCATGTCCCCCTGTGGGGCTTGTACACCATCCATGTTTGGTGAGGGGACATCC
AACTGGCAAAAGTCCCTTAGTGTAAATCTCTGGGGTGAGGACAGAG
gtgggcacgctggctctcgagtacacctctcaggggcagacacaccctggacccatccac
cctactgtggtgccaagccgtcggcccacacgagtgggggcgtatgctgccttctgtctg
cagcatggtgactgtgtcccaaagcagggacttctgaggtccatctacctctttagtagc

 2.02 Intr +  36890  36942   53  0  2  129   83   -15 0.614   1.22
cctcgcatgtctctccctctcccgtgatgaccaactcatccctcattgaactcggctgcc
ctttctcagggtcactggtccttctcctgaaagtgccctgttttctcgtctttcttcatc
caaggccagctcactcaccttctcccccagagcctcactaccttctcttttcctctgcag
AGATGGCTCCGAAGTCAAAAAAGAAGGGGCACCCCGGGAGGGAGCAGAAGAAG
gtacatgggctcaggggcatccttcattaggtgggacgttgggtctggcccgggccagtt
ctgcctgcctgacatcagcctgtctgtctgtctgtctctctgtctgcagcaccatcatca
ccaccatcagcagatgcagcaggccccggctcctgtgccccagcagccgcccccgcctcc

 2.03 Intr +  37052  37421  370  1  1  128   99   308 0.997  31.14
ttctcttttcctctgcagagatggctccgaagtcaaaaaagaaggggcaccccgggaggg
agcagaagaaggtacatgggctcaggggcatccttcattaggtgggacgttgggtctggc
ccgggccagttctgcctgcctgacatcagcctgtctgtctgtctgtctctctgtctgcag
CACCATCATCACCACCATCAGCAGATGCAGCAGGCCCCGGCTCCTGTGCCCCAGCAGCCG
CCCCCGCCTCCCCAGCAGCCCCCACCGCCTCCACCTCCGCAGCAGCAACAGCAGCCGCCA
CCCCCGCCTCCCCCACCCTCCATGCCGCAGCAGGCAGCCCCGGCGATGAAGTCCTCGCCC
CCACCCTTCATTGCCACCCAGGTGCCCGTCCTGGAGCCCCAGCTCCCAGGCAGCGTCTTT
GACCCCATCGGCCACTTCACCCAGCCCATCCTGCACCTGCCGCAGCCTGAGCTGCCCCCT
CACCTGCCCCAGCCGCCTGAGCACAGCACTCCACCCCATCTCAACCAGCACGCAGTGGTC
TCTCCTCCAG
gtgagccgtggcctgccccagtgtgggttgagaccccttcctgcctcggtttacccatgt
ggtgtccgagcactctggctgggcagcttcttagcctcagctgctctggtctctagaggg
aagatctgtggcttctcgaggccatcttggaagttaaaggagatgcctcaagacaggtca

 2.04 Intr +  38165  38752  588  0  0  101  131   509 0.969  49.71
ctggaagctgtttactgctctggagtttgtgggaggccacggtaggtggggagggagtgc
cagtttgagggaggccagtaggagagcactggagtccagatgaggtcaggatggagcaga
aaggccaggctggggccacaggtgctcaggcctcaccgcctcggtgttgtgttcttccag
CTTTGCACAACGCACTACCCCAGCAGCCATCACGGCCCAGCAACCGAGCCGCTGCCCTGC
CTCCCAAGCCCGCCCGGCCCCCAGCCGTGTCACCAGCCTTGACCCAAACACCCCTGCTCC
CACAGCCCCCCATGGCCCAACCCCCCCAAGTGCTGCTGGAGGATGAAGAGCCACCTGCCC
CACCCCTCACCTCCATGCAGATGCAGCTGTACCTGCAGCAGCTGCAGAAGGTGCAGCCCC
CTACGCCGCTACTCCCTTCCGTGAAGGTGCAGTCCCAGCCCCCACCCCCCCTGCCGCCCC
CACCCCACCCCTCTGTGCAGCAGCAGCTGCAGCAGCAGCCGCCACCACCCCCACCACCCC
AGCCCCAGCCTCCACCCCAGCAGCAGCATCAGCCCCCTCCACGGCCCGTGCACTTGCAGC
CCATGCAGTTTTCCACCCACATCCAACAGCCCCCGCCACCCCAGGGCCAGCAGCCCCCCC
ATCCGCCCCCAGGCCAGCAGCCACCCCCGCCGCAGCCTGCCAAGCCTCAGCAAGTCATCC
AGCACCACCATTCACCCCGGCACCACAAGTCGGACCCCTACTCAACCG
gtaagtggtcctcacccgtagactctggggaggctggtgctgggcctatagttttgtcct
caggaagccagaagggttaactcatgcttcaggctgcagtgggttcagagctgagcctca
gcttggagggggacctggaagggtcattggtgcttcctacagtgtgtgtttatcaggtgt

 2.05 Intr +  41630  41742  113  0  2  132   93    11 0.883   6.60
caggcccagtcacttgtgtgggtcttcaccctttttgagctgggctaatggacccttgtc
ccagggcctgggcggcacatgcagtttctccatacagcccacgttttccttcccgacaat
tctctcagggccagcagttctaagccagccccttgacacattccttgtcccttctcctag
GTCACCTCCGCGAAGCCCCCTCCCCGCTTATGATACATTCCCCCCAGATGTCACAGTTCC
AGAGCCTGACCCACCAGTCTCCACCCCAGCAAAACGTCCAGCCTAAGAAACAG
gtaactggcagggctgggccatagtcctgtgggctagggccgggggtgcctgcccacctc
accggccgctgtgcctgtgccatcccaggagctgcgtgctgcctccgtggtccagcccca
gcccctcgtggtggtgaaggaggagaagatccactcacccatcatccgcagcgagccctt

 2.06 Intr +  41831  41993  163  1  1   79   75   263 0.970  24.16
ccccgcttatgatacattccccccagatgtcacagttccagagcctgacccaccagtctc
caccccagcaaaacgtccagcctaagaaacaggtaactggcagggctgggccatagtcct
gtgggctagggccgggggtgcctgcccacctcaccggccgctgtgcctgtgccatcccag
GAGCTGCGTGCTGCCTCCGTGGTCCAGCCCCAGCCCCTCGTGGTGGTGAAGGAGGAGAAG
ATCCACTCACCCATCATCCGCAGCGAGCCCTTCAGCCCCTCGCTGCGGCCGGAGCCCCCC
AAGCACCCGGAGAGCATCAAGGCCCCCGTCCACCTGCCCCAGC
gtgagtgctctccctgcccacagccagggctcaggccccccgaggcccgtgttggacata
agcttgctgtggggctggtggaccatgccccactggggtgaggtgggccagggcccaccg
gctgtttatgttccagggccggaaatgaagcctgtggatgtcgggaggcctgtgatccgg

 2.07 Intr +  42130  42260  131  2  2   79   53   127 0.910   9.22
caagcacccggagagcatcaaggcccccgtccacctgccccagcgtgagtgctctccctg
cccacagccagggctcaggccccccgaggcccgtgttggacataagcttgctgtggggct
ggtggaccatgccccactggggtgaggtgggccagggcccaccggctgtttatgttccag
GGCCGGAAATGAAGCCTGTGGATGTCGGGAGGCCTGTGATCCGGCCCCCAGAGCAGAACG
CACCGCCACCAGGGGCCCCTGACAAGGACAAACAGAAACAGGAGCCGAAGACTCCAGTTG
CGCCCAAAAAG
gttgggatggaggtccatgggtgtcgcttgccccttggccctggaaggtgccatgctggg
cacacccccagctatgccctttaggcacagcagacccctcacccaccccaacctctctgt
tctgcaggacctgaaaatcaagaacatgggctcctgggccagcctagtgcagaagcatcc

 2.08 Intr +  42388  42593  206  0  2  140   64   344 0.936  35.72
ctgacaaggacaaacagaaacaggagccgaagactccagttgcgcccaaaaaggttggga
tggaggtccatgggtgtcgcttgccccttggccctggaaggtgccatgctgggcacaccc
ccagctatgccctttaggcacagcagacccctcacccaccccaacctctctgttctgcag
GACCTGAAAATCAAGAACATGGGCTCCTGGGCCAGCCTAGTGCAGAAGCATCCGACCACC
CCCTCCTCCACAGCCAAGTCATCCAGCGACAGCTTCGAGCAGTTCCGCCGCGCCGCTCGG
GAGAAAGAGGAGCGTGAGAAGGCCCTGAAGGCTCAGGCCGAGCACGCTGAGAAGGAGAAG
GAGCGGCTGCGGCAGGAGCGCATGAG
gtgggcgggtgtctgggtggggcatggggactcttggggccacaccagtccccaggctga
ctgggaccctctgcccaggagccgagaggacgaggatgcgctggagcaggcccggcgggc
ccatgaggaggcacgtcggcgccaggagcagcagcagcagcagcgccaggagcaacagca

 2.09 Intr +  42672  42909  238  0  1   34   78   447 0.861  36.45
ccgccgcgccgctcgggagaaagaggagcgtgagaaggccctgaaggctcaggccgagca
cgctgagaaggagaaggagcggctgcggcaggagcgcatgaggtgggcgggtgtctgggt
ggggcatggggactcttggggccacaccagtccccaggctgactgggaccctctgcccag
GAGCCGAGAGGACGAGGATGCGCTGGAGCAGGCCCGGCGGGCCCATGAGGAGGCACGTCG
GCGCCAGGAGCAGCAGCAGCAGCAGCGCCAGGAGCAACAGCAGCAGCAGCAACAGCAAGC
AGCTGCGGTGGCTGCCGCCGCCACCCCACAGGCCCAGAGCTCCCAGCCCCAGTCCATGCT
GGACCAGCAGAGGGAGTTGGCCCGGAAGCGGGAGCAGGAGCGAAGACGCCGGGAAGCC
gtgagtctggaggcctggtggggaccctggtctaaggattagctcctgagggagctggga
aagggggactggagcctggacagggaggggcagcgggggagccccgtccctgctggtcgg
catgtggtcctctggactcagctgtagggccctgagtgctgtgtggacggggtgagcgct

 2.10 Term +  43207  43275   69  0  0  143   53    33 0.425   3.53
cggcatgtggtcctctggactcagctgtagggccctgagtgctgtgtggacggggtgagc
gctatgaggggtcagccacggggagggctacggggctgactgctggtagcgggtatgagg
gcttgtagctgcagggtggctaggtcatcctcctgactccctccttcctttctcctccag
ATGGCAGCTACCATTGACATGAATTTCCAGAGTGATCTATTGTCAATATTTGAAGAAAAT
CTTTTCTGA
gcgcacctaggtggcttctgactttgattttctggcaaaacattgactttccatagtgtt
aggggcggtggtggaggtgggatcagcggccaggggatgcctcagggcctggccctcctg
catgctatgcccggggcaggcctgacgggcagctgaggattgcagagcctgtctgcctta

Predicted peptide sequence(s):


>BRD4_1|GENSCAN_predicted_peptide_1|906_aa
XVPGEECDGITSMSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPP
ETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPPSPPGQFHELCQN
LTYHLLMPVGAVAPVDLPVEQPGDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTM
FTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGTAKPG
VSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPP
VPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLPPE
PKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAY
AWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKVSGMCLREGTSLRKSKTSPLALGAQCPR
YLAHTVDAPWELGLGGLASLFVVEKALLSPLCWRHASKLEAREYRDAQEFGADVRLMFSN
CYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDS
SSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKK
EKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEEDKCK
PMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELE
RYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETAFCTSGDFV
SPGPSPYHSHVQCGRFREMLRWFLVDVEQTAAGQPHRQSAAGPAITWAPAIAYPSPECAR
CCVGCS

>BRD4_1|GENSCAN_predicted_peptide_2|698_aa
MGPASHLVAGDCDLPAHEHWPGLMSPCGACTPSMFGEGTSNWQKSLSVNLWGEDREMAPK
SKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPS
MPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPE
HSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPP
MAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHP
SVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPP
GQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSP
PQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPV
HLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWAS
LVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSRE
DEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQ
RELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF