GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:35:09

Sequence BCAT2_1 : 18343 bp : 54.67% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1047   1224  178  0  1   74   94    46 0.405   4.24
ttgtatttttagtagagacggggtttcatcatgttggaccaggctggtctctaactcctg
acctcaggtaatccgcccgcttcggcctcccaaagtgctaagattacagacctgagccac
ttcgcctggcagggaccgtatttcaagtcctgccctcccaccagcgcctgcgccccgcag
CAGTGTCCGGCTCCCTGCCGACGCCCTGGAGCTGGGACGGCCTGGGGCGCTGGTCGGCCG
CCTTCCCCCAGAAGGAGGCGTGAGCGGGGCGTGGCCGGAACGTCTCTCTTCGGAGCCGCG
CCCCGGGCGGGCACAGTTACGCGCCGCACGGATCATGGCCGCAGCCGCTCTGGGGCAG
gtgggttcgcagccccgcgccggggtctgggaaataaccgggggaggcgcacttccggga
agaccactggcctgcagccggtccgactcggcgccgctcctcccgccctggggttccgct
gcagggcgcggaggaggatggcgccctttggaaaggagcacgaggctttaatggggtgag

 1.02 Intr +   4238   4354  117  1  0  118   45     3 0.494   0.17
gagcctcacaccagcaagaccacgctgcaggcccatctcccagcaactcacctagcgaca
agtgaccacgcccattcacgtccatcttccagaatcagtgccaactcacccagctcacag
ggcaggccaggccaggccactctgtctctctcaacctcacgccccaacgcctccccacag
GGCTGGGGAAAGAGGCCTTGTGAGGTCAAAGGTCACCAGAGAGGGCCCAGCCTGCTGGAC
ACAGCCAGACCTGCTCTTCCTACTCCCCTCTGGGAGGACCCGCCTGAGCCTCATGCA
gtgaggactgcagtggctccccaggcccctgtagctgcccctcagccccaggggctgaag
ggaattggagtcactgccaaaatgggtttgtatttcaggtaatcagagcccagttgatcg
aataccttcagagaataagcacctgtactcctgggtctggcggaggaggggctggggaac

 1.03 Intr +   5491   5691  201  0  0   77   38   235 0.993  17.40
gtggtagcttaacagcctgccattgggccgcagacaagggatgaaactgcatgtcccaga
atcctccagggtgacaggtccttcttctctatgggtctgaggcccagggcttcatgggag
ttgtagtttttcagctgggaggttgtggccagattctaggatacccctgtctttcctcag
GCTGCAGACCTGCAGCTGGAAATGACACAGAAGCCTCATAAGAAGCCTGGCCCCGGCGAG
CCCCTGGTGTTTGGGAAGACATTTACCGACCACATGCTGATGGTGGAATGGAATGACAAG
GGCTGGGGCCAGCCCCGAATCCAGCCCTTCCAGAACCTCACGCTGCACCCAGCCTCCTCC
AGCCTCCACTACTCCCTGCAG
gtggcatggcggccggcctctctccctgtccctgtctgcatctcctcctccttgctgtgt
ctcttgccaggtgtacctctcttggtttgtttgttgtgtgtttctcctttctgtgcattc
accatttgttttctgaggccttccatgctccaggctcatgcttggtgatgctgggttccc

 1.04 Intr +  11911  12021  111  0  0  100   93   180 0.994  20.78
tatatctgtctctctttttctccatctctctgacccagctgctaaatctccccggtgctc
tcctcttggcctccatctttcagttgtctgtgtctttgtgtatctgtctctgtctgtctt
ggtgtctctcatgactgtctggagaagtctctgagcctccccacccgcgtgtccccgcag
CTGTTTGAGGGCATGAAGGCGTTCAAAGGCAAAGACCAGCAGGTGCGCCTCTTCCGCCCC
TGGCTCAACATGGACCGGATGCTGCGCTCAGCCATGCGCCTGTGCCTGCCG
gtgaggggtcccggtccaccggggtggggaggagggctggggccggggcagcaagggccc
cttgactcattcagaatcccacccagagtttcgacaagctggagttgctggagtgcatcc
gccggctcatcgaagtggacaaggactgggtccccgatgccgccggcaccagcctctatg

 1.05 Intr +  12108  12227  120  2  0   23   64   268 0.743  19.09
ggcgttcaaaggcaaagaccagcaggtgcgcctcttccgcccctggctcaacatggaccg
gatgctgcgctcagccatgcgcctgtgcctgccggtgaggggtcccggtccaccggggtg
gggaggagggctggggccggggcagcaagggccccttgactcattcagaatcccacccag
AGTTTCGACAAGCTGGAGTTGCTGGAGTGCATCCGCCGGCTCATCGAAGTGGACAAGGAC
TGGGTCCCCGATGCCGCCGGCACCAGCCTCTATGTGCGGCCTGTGCTCATTGGGAACGAG

gtgggcccaactccagggctgggaagctgggctgcgggggttggattctgcagggcaggg
gtggggtcctggaggcctgggcctggggacgggaagggactgggggcctggactcctgac
gctgtccctttgcccgtcgcagccctcgctgggtgtcagccagcccacgcgcgcgctcct

 1.06 Intr +  12370  12533  164  0  2  137  106   168 0.506  22.79
ccagcctctatgtgcggcctgtgctcattgggaacgaggtgggcccaactccagggctgg
gaagctgggctgcgggggttggattctgcagggcaggggtggggtcctggaggcctgggc
ctggggacgggaagggactgggggcctggactcctgacgctgtccctttgcccgtcgcag
CCCTCGCTGGGTGTCAGCCAGCCCACGCGCGCGCTCCTGTTCGTCATTCTCTGCCCAGTG
GGTGCCTACTTCCCTGGAGGCTCCGTGACCCCGGTCTCCCTCCTGGCCGACCCAGCCTTC
ATCCGGGCCTGGGTGGGCGGGGTCGGCAACTACAAGTTAGGTGG
gtaagtagcacccccatccccagaacgactggcgcactgggcgttggagacacagggacc
agcgtgcgtgctttcggccatgcctctggatgtcacatgaaggtgacatcatcagcaccg
tgcagggctcagtgctaagtgacctccctggtccctgaaaacaaaccatggaaggaagga

 1.07 Intr +  14875  15017  143  1  2   61   86   230 0.613  20.61
ataaccatttagggtcctgatgccaaatgaaaagtcaaggattccatctcaggggaactg
gggagccctgtgagagctgtgagcagggagacgggagagagtaggatgagcctcctctgg
ggctgggctggggaaggatggggctcccttgccccacccaaccagactgccctccaccag
GAATTATGGGCCCACCGTGTTAGTGCAACAGGAGGCACTCAAGCGGGGCTGTGAACAGGT
CCTCTGGCTGTATGGGCCCGACCACCAGCTCACCGAGGTGGGAACCATGAACATCTTTGT
CTACTGGACCCACGAAGATGGGG
gtaagcccacccatgacccagcccgaaccctggtggaagtgggtggcaccatcattcctg
gcaggttacaggccccagggattctgggatgggggaagggggtggctcttaagacggcgg
tgctagggggtgagaggtaacatcttccaccccttacacctgccctagtgctggagctgg

 1.08 Intr +  15186  15271   86  1  2   57   68    69 0.699   1.84
acgaagatgggggtaagcccacccatgacccagcccgaaccctggtggaagtgggtggca
ccatcattcctggcaggttacaggccccagggattctgggatgggggaagggggtggctc
ttaagacggcggtgctagggggtgagaggtaacatcttccaccccttacacctgccctag
TGCTGGAGCTGGTGACGCCCCCGCTGAATGGTGTTATCCTGCCTGGAGTGGTCAGACAGA
GTCTACTGGACATGGCTCAGACCTGG
gtgaggacatggcatcttctggtgatgggcgccatgtgccaggggccagggcatcagagg
gctgggactggggcacactggcatgtctctgccccttctcctgggtctgtctctcccgtt
gggcctctgtctttctcactatcctcagggagggagaggtggaggtctgcagcagggcaa

 1.09 Intr +  15490  15630  141  0  0   88   72   235 0.752  22.96
ccaggggccagggcatcagagggctgggactggggcacactggcatgtctctgccccttc
tcctgggtctgtctctcccgttgggcctctgtctttctcactatcctcagggagggagag
gtggaggtctgcagcagggcaaccctctggggacacgtgtctctgccaactgccctgcag
GGTGAGTTCCGGGTGGTGGAGCGCACGATCACCATGAAGCAGTTGCTGCGGGCCCTGGAG
GAGGGCCGCGTGCGGGAAGTCTTTGGCTCGGGCACCGCTTGCCAGGTCTGCCCAGTGCAC
CGAATCCTGTACAAAGACAGG
gtgaggcggggctgccattgtgggtgggagggaaggaggggaggggcttggtcctcaccg
caccttctgtcccagaacctccacattcccaccatggaaaatgggcctgagctgatcctc
cgcttccagaaggagctgaaggagatccaggtgagctgcagggagctggggaatgggctg

 1.10 Intr +  15706  15780   75  0  0   56   99   142 0.993  12.31
aagcagttgctgcgggccctggaggagggccgcgtgcgggaagtctttggctcgggcacc
gcttgccaggtctgcccagtgcaccgaatcctgtacaaagacagggtgaggcggggctgc
cattgtgggtgggagggaaggaggggaggggcttggtcctcaccgcaccttctgtcccag
AACCTCCACATTCCCACCATGGAAAATGGGCCTGAGCTGATCCTCCGCTTCCAGAAGGAG
CTGAAGGAGATCCAG
gtgagctgcagggagctggggaatgggctgggagcttgttccctggagaagttggtgtcc
catgagcccctggactaacagccagcctccttcagtagtaccaggaacagataatggcct
ttcttattgaggccctggagagtgggctttctgtgctgctctgtggcctggaaaacccct

 1.11 Intr +  16744  16776   33  0  0  109   62    32 0.278   1.60
tgcgccgccttagccttgattccccgttcccatcattgttggggccctctgggaagtgga
ctacatttcccgtgagccgctggggcacagctccgtaggcactcggcctggaacacccca
gggcctactgggagttgtagtgcagcttccacctcacgcactgcctccgttgttccgcag
TACGGAATCAGAGCCCACGAGTGGATGTTCCCG
gtgtgaagctgcaggctgtgctccagatccaccgacccgtagcatctcgtcacgccagca
ctcgcctccctaccaatgactcacctgaagtgcaatacgaaataaaaggccagcgggcgg
cgtctgggtctctggcgcccccatgtggttgcgacactcccaaagccgtaagggccgacc

 1.12 Term +  17471  17623  153  1  0  130   54    37 0.910   2.73
cggcactgaacttactatctgccccccaccaaccagctcctcccctactttcccgtctcc
cagtctctaggccggacccctaggtgctgcatccttttctctcaaagcccacgaggcccc
gatccctgttcctcctgcccccgactctgctgtccgttcccccgcctctttgtcccctag
GCCCTGGCCTCAGCTCAGCTGCTGTCTTCTACTGGCACCCTTGTTCCAGCCTGCAGTCTG
CTACCTGGCCCAAAGGGTCTTTTCTACACCCAGACGTGGCCCAGTGCCCTCAGCCAGGAC
TGTAGTCACGGGACCCTAGTGGGTGTGGAGTGA
ggcacgatactctcacctgctggagggattaaacgtggaagagtttagactgggtatggt
gactcccacctgcaattccagcactgtgggaggctgaggcgggaggattgcttgagacca
ggctgggcaacacagtgagatcccatctgtacagaaaatacagaaaattaaccaggtgag

Predicted peptide sequence(s):


>BCAT2_1|GENSCAN_predicted_peptide_1|507_aa
XSVRLPADALELGRPGALVGRLPPEGGVSGAWPERLSSEPRPGRAQLRAARIMAAAALGQ
GWGKRPCEVKGHQRGPSLLDTARPALPTPLWEDPPEPHAAADLQLEMTQKPHKKPGPGEP
LVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQ
VRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLI
GNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNY
GPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILP
GVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKD
RNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPALASAQLLSSTGTLVPACSLLPG
PKGLFYTQTWPSALSQDCSHGTLVGVE