GENSCAN 1.0	Date run: 15-Jan-104	Time: 16:32:38

Sequence YES1_1 : 37494 bp : 39.52% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1203   1481  279  1  0   97   94   195 0.918  17.53
aattgtaataaagataaatgaggggaagagacctcgttttcagctttctattttttgttt
tgtttatgttcctttttgcagggatggcatatgcttttcttaaaatgattttttgaaccc
tgtctttttgaagtatcctgtgtgttaactgactctcaaaatattttattgtctctgtag
ATTTGATAATGGGCTGCATTAAAAGTAAAGAAAACAAAAGTCCAGCCATTAAATACAGAC
CTGAAAATACTCCAGAGCCTGTCAGTACAAGTGTGAGCCATTATGGAGCAGAACCCACTA
CAGTGTCACCATGTCCGTCATCTTCAGCAAAGGGAACAGCAGTTAATTTCAGCAGTCTTT
CCATGACACCATTTGGAGGATCCTCAGGGGTAACGCCTTTTGGAGGTGCATCTTCCTCAT
TTTCAGTGGTGCCAAGTTCATATCCTGCTGGTTTAACAG
gtgagatttaaatggacaattatgttgtctgtttgagaacatcaccttgggtaatatata
cttaaggcttgtctgcctttaagaaagatatcttacttgaggacttttcaaataattgta
tgtgaaaatcagtctctaacataaaaattagttttattgtatacatgggtatggttctgg

 1.02 Intr +   6234   6333  100  1  1   98  102    55 0.995   6.15
aatatggtcatgtctctctactttaaaattcttcagtagttccaacttctaaaaatagtt
tctggagactacagaaaaaactatccttaagcttttttttttttggctggcaatagttct
ttttttctgttttgttaagttagctacataatttaccttggtcttttttccctctgatag
GTGGTGTTACTATATTTGTGGCCTTATATGATTATGAAGCTAGAACTACAGAAGACCTTT
CATTTAAGAAGGGTGAAAGATTTCAAATAATTAACAATAC
gtaagtgtcatgaatattttgtgagagaaatactgacagaaatctggtctttacacagga
accactgagctggttgatgatccagagatgagagaggtagggcatgggctgcccactgtg
tttaacgatgcattggcttctatagatgcatgttgcaacactgctgctgtagccagaagt

 1.03 Intr +   7446   7546  101  0  2   97   75    90 0.686   7.43
atatgtcctttctcaagatgcctttccttaacattcttcctcccctgcctggcccagtcc
ttatcccctgctggattaagtatctctcttaggtgtttacatagcaccctatgcaaacct
caatcatagctgtcatcacattttgaattacaatttgtcacttgcttgttattcttttag
ACCAATGGTTCTCAACCTGGGACAGAATCACCCAGGGGATATTTGGCAGTATCTGGAGAC
ATTTTTGGTTGTCACAGTTGGGGTGCTGCCGCTGTCTTCTA
gtgagtagtggccagggatattggtaaatatcttaaaacgcacacagcagcctcccacaa
caaagaatgatcaagtccaaggtgtcaatagtgctgaagttggaaaacccagctctagac
tgtgaattccttgaagtcaaggactgtctttttacttttatttccagcacactctaaagt

 1.04 Intr +  12181  12330  150  2  0   45   91    66 0.777   1.81
aaatggggagaaaagatgctgaaagattacttttgaatcctggaaatcaacgaggtattt
tcttagtaagagagagtgaaacaactaaaggtatgaatattgttatattagtataagtat
aaaatttcttggggcagtattttgagaaagatatagtgaaagtatttatttttcacccag
GTGCTTATTCCCTTTCTATTCGTGATTGGGATGAGATAAGGGGTGACAATGTGAAACACT
ACAAAATTAGGAAACTTGACAATGGTGGATACTATATCACAACCAGAGCACAATTTGATA
CTCTGCAGAAATTGGTGAAACACTACACAG
gtatgtgaatatttcaaaggtaaaaattatttcttcatattctagtttatgaggacaaaa
tccatatcctcatttctcttaagatttaacacacttatttacacataatacatgcccaat
aaatgtctgttgtattctaaagggaggaacaggtaatacttagtacttgcattgtgctac

 1.05 Intr +  14623  14778  156  2  0   40   86   175 0.999  11.56
tatgtatatttcatgttttgctgcttatggacaactccctttttgttttgtgcttttaga
gtaaaactcgaaaggacttctgtttttgtttttctacagtttaaacttaaaacattgata
cactatatgccccttaatttttgtaattgatattacagtatagtttattcatttatctag
AACATGCTGATGGTTTATGCCACAAGTTGACAACTGTGTGTCCAACTGTGAAACCTCAGA
CTCAAGGTCTAGCAAAAGATGCTTGGGAAATCCCTCGAGAATCTTTGCGACTAGAGGTTA
AACTAGGACAAGGATGTTTCGGCGAAGTGTGGATGG
gtaagaagcctgaatttttgttttctgtcattgtttagctgtggattaaagtgcaacaat
ttatgataaaatatgtttcaatatttaagagaagtgctgttcactgaagtttggtctaaa
atcctttaaaatataaattcctaaaatgtgttatttctttaggaacatggaatggaacca

 1.06 Intr +  14941  15120  180  2  0   74   95   155 0.999  13.72
tcggcgaagtgtggatgggtaagaagcctgaatttttgttttctgtcattgtttagctgt
ggattaaagtgcaacaatttatgataaaatatgtttcaatatttaagagaagtgctgttc
actgaagtttggtctaaaatcctttaaaatataaattcctaaaatgtgttatttctttag
GAACATGGAATGGAACCACGAAAGTAGCAATCAAAACACTAAAACCAGGTACAATGATGC
CAGAAGCTTTCCTTCAAGAAGCTCAGATAATGAAAAAATTAAGACATGATAAACTTGTTC
CACTATATGCTGTTGTTTCTGAAGAACCAATTTACATTGTCACTGAATTTATGTCAAAAG

gtatgtattagtatctccttaggtatttgtgttgataatgtttttaagagtcttgatttg
tatgcatatagacttatactgttttctaatttaagatttttatgtagacatatttggata
gaagaaacctgacactttgtttaatggaatagtgattatccagttattccagaggatagt

 1.07 Intr +  18227  18303   77  0  2  101   70    60 0.989   3.82
tcagcttagagacctcttctaggacctagataattatttggaaactgcaaaactgcacaa
aatttaaaaaaaatgaaaagctaagaagttttgtgttgtgatttggggtggaggagtatt
catttcaatcctaatataagatttgcttattttttatgaatatcttgctgtctgttacag
GAAGCTTATTAGATTTCCTTAAGGAAGGAGATGGAAAGTATTTGAAGCTTCCACAGCTGG
TTGATATGGCTGCTCAG
gtatctgtatatatacatgtatccatttgaattaaaagtgtaaattaaaatgtggaataa
tcttaccagaatattatagtatgtgtagtgaaatggtgggattttatttttattttttat
tttttagagacagcgtctcattctgtcacccagggtggaatgcagtggtgcactgatagc

 1.08 Intr +  21077  21230  154  1  1   61   93   137 0.977  10.22
cctgcatttttattatgttttctggttttcctgttatcttctagactataccctgttacc
atcatctccttctaaaataatatgattttcagtgacacaatttgatattaaccataattg
tcttctctctgcttccctttgtatcgtatgtcttgtgttttttgtttttctctttccaag
ATTGCTGATGGTATGGCATATATTGAAAGAATGAACTATATTCACCGAGATCTTCGGGCT
GCTAATATTCTTGTAGGAGAAAATCTTGTGTGCAAAATAGCAGACTTTGGTTTAGCAAGG
TTAATTGAAGACAATGAATACACAGCAAGACAAG
gtaaaattacttttacataaaagcttgtaatgtgttgtgtgttttgcttaactctcttga
ctatacagggttttccagaataagaattgttttagcttccctcagaagagtcatagagac
attgatttcattcataaaatcatgtactgctgtggctttctgatagttatttcctccaag

 1.09 Intr +  25073  25204  132  0  0   27  115    66 0.214   2.90
tttatttcaatatgaattttaaaaattaaagaatttttatcccatgtatcttgtacattt
aaagaattgacactgatgactacagtagagatattgacagaacattagccctgcatatgc
tatgtttacacaaatagatttttaaaaaacaattaagcaagatggtcaacattattttag
GTGCAAAATTTCCAATCAAATGGACAGCTCCTGAAGCTGCACTGTATGGTCGGTTTACAA
TAAAGTCTGATGTCTGGTCATTTGGAATTCTGCAAACAGAACTAGTAACAAAGGGCCGAG
TGCCATATCCAG
gtaagcttgcattttatagctcttggttatctcatgagtggctttatcaggagtttatta
ggaacagaattgtaagcggggaaaaggcctttatttcttctcatagtccccctgcctctc
cctctccccactccttccctttactgtggcattggatgggtaactgtggcattggacggg

 1.10 Term +  33406  33614  209  2  2   81   31   186 0.985   8.72
attagcattttctaagctcttcttgatattctcatgtttaaaatttattttgttgctttg
ttaaaagaattgtttcactaaataatatactttgaatgagttagtggctagggggtttgt
tatgttttcctagtggtagttaggaccattgttctttaatgttttaatcttgtgtattag
GTATGGTGAACCGTGAAGTATTAGAACAAGTGGAGCGAGGATACAGGATGCCGTGCCCTC
AGGGCTGTCCAGAATCCCTCCATGAATTGATGAATCTGTGTTGGAAGAAGGACCCTGATG
AAAGACCAACATTTGAATATATTCAGTCCTTCTTGGAAGACTACTTCACTGCTACAGAGC
CACAGTACCAGCCAGGAGAAAATTTATAA
ttcaagtagcctattttatatgcacaaatctgccaaaatataaagaacttgtgtagattt
tctacaggaatcaaaagaagaaaatcttctttactctgcatgtttttaatggtaaactgg
aatcccagatatggttgcacaaaaccacttttttttccccaagtattaaactctaatgta

Predicted peptide sequence(s):


>YES1_1|GENSCAN_predicted_peptide_1|512_aa
XLIMGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSL
SMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGER
FQIINNTPMVLNLGQNHPGDIWQYLETFLVVTVGVLPLSSSAYSLSIRDWDEIRGDNVKH
YKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWE
IPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDK
LVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMN
YIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTI
KSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKK
DPDERPTFEYIQSFLEDYFTATEPQYQPGENL