GENSCAN 1.0	Date run: 15-Jan-104	Time: 16:32:10

Sequence TYMS_1 : 18241 bp : 45.62% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1293   1497  205  2  1   92   51   350 0.922  30.71
gggggccgccgcgaccccgccgagcaggaagaggcggagcgcgggacggccgcgggaaaa
ggcgcgcggaaggggtcctgccaccgcgccacttggcctgcctccgtcccgccgcgccac
ttggcctgcctccgtcccgccgcgccacttcgcctgcctccgtcccccgcccgccgcgcc
ATGCCTGTGGCCGGCTCGGAGCTGCCGCGCCGGCCCTTGCCCCCCGCCGCACAGGAGCGG
GACGCCGAGCCGCGTCCGCCGCACGGGGAGCTGCAGTACCTGGGGCAGATCCAACACATC
CTCCGCTGCGGCGTCAGGAAGGACGACCGCACGGGCACCGGCACCCTGTCGGTATTCGGC
ATGCAGGCGCGCTACAGCCTGAGAG
gtgacgccgcgggcccctgcgggacgggtggcgggaaggagggaggcgcggctggggaga
gcgctcgggagctgccgggcgctgcggaccccgtttagtcctaacctcaatcctgcgagg
gaggggacgcatcgtcctcctcgccttacagacgccgaaacggagggtcccattagggac

 1.02 Intr +   1649   1719   71  0  2   89   99    53 0.888   5.40
cggcatgcaggcgcgctacagcctgagaggtgacgccgcgggcccctgcgggacgggtgg
cgggaaggagggaggcgcggctggggagagcgctcgggagctgccgggcgctgcggaccc
cgtttagtcctaacctcaatcctgcgagggaggggacgcatcgtcctcctcgccttacag
ACGCCGAAACGGAGGGTCCCATTAGGGACGTGACTGGCGCGGGCAACACACACAGCAGCG
ACAGCCGGGAG
gtaagccgcgtcccagcggctccgcggccgggctcgcagtcgccccagtgatgccgtggc
ccccgaggcgggcgtcatcgggcagcgtttgcccagtgctggagggttagggagagctgc
ctgggcttgaccgcgcgccggtctcaaagtcctggctttggcccctcctccgttttcccc

 1.03 Intr +   5696   5870  175  1  1  123   94   127 0.402  16.31
caagagcgaaactctcaaaaaacaaaaaaaaggatgggttccatatgggtggtgtcaagt
gcccacctcctagcaagtcagcaggggccagaggcccttgtaagtggtgtctcgggggga
tcaactgagatggcttaggatttacctggatgcctgctctgctctccccatctcttccag
GGATCCACAAATGCTAAAGAGCTGTCTTCCAAGGGAGTGAAAATCTGGGATGCCAATGGA
TCCCGAGACTTTTTGGACAGCCTGGGATTCTCCACCAGAGAAGAAGGGGACTTGGGCCCA
GTTTATGGCTTCCAGTGGAGGCATTTTGGGGCAGAATACAGAGATATGGAATCAG
gtgaggagatagaacaatgccttccatttcccgggtgcccttcctagcatgtgtttgctc
cgttgttttagataaggtctgggggatgagtcaatgtcacaggagctgatgtatagcttt
gaccttgtgaggggtggtgccaggttaagccacaattaagcctcatgaaggccgtttcac

 1.04 Term +   6339   6346    8  1  2   42   54     0 0.012  -9.97
acccactaactcatgatctagcatcaggtatatctcccaatgctatccctcccccctcct
cccaccccacaacagtccccagagtgtgatgttccccttcctgtgtccatatgttctcgt
tgttcaattcccacctatgagtgagaatatgcagtgtttggttttttgttcttgcgatag
TTTACTGA
gaatgatgatttccaatttcatccacgtccctacaaaggacatgaactcatcatttttta
tggctgcatagtattccatggtgtatatgtgccacattttcttaatccagtctatcattg
ttggacatttgggttggttccaagtctttgctattgtgaatagtgccacaataaacatac

 2.02 PlyA -   6545   6540    6                              -3.94
 2.01 Sngl -   8826   6556 2271  0  0   70   35   519 0.355  38.09
 2.00 Prom -   9140   9101   40                              -9.26

 3.03 PlyA -   9300   9295    6                               1.05
 3.02 Term -  11212  10417  796  0  1   66   42  1123 0.947  98.26
 3.01 Init -  12748  12681   68  1  2   41    7    49 0.205  -9.31
 3.00 Prom -  13110  13071   40                             -13.33

 4.01 Init +  14253  14417  165  2  0   47   86   256 0.655  20.93
tccgtgccatcgctgcagaggctgttatggacatcactgcagcccagtggctctctctcc
tggtctccaccatatgagttggcttctgtttctctcctgttttactttgcctttagctgt
ggtctttcaaaccaccatccctccttatcttcctctgctggttcctcagatcttcctctg
ATGGCGCTGCCTCCATGCCATGCCCTCTGCCAGTTCTATGTGGTGAACAGTGAGCTGTCC
TGCCAGCTGTACCAGAGATCGGGAGACATGGGCCTCGGTGTGCCTTTCAACATCGCCAGC
TACGCCCTGCTCACGTACATGATTGCGCACATCACGGGCCTGAAG
gtgggctgtctcgggaagggtgacttgccagcctaccacactgagctcttcagttcttta
atatgggaaaacaaattgcagagtttagtctctgattagcttttaaatttgatatgtgta
agtaagaaatgaaccagcttttactttgaaaccttcctcttctggaaggttttctggccc

 4.02 Term +  16410  16547  138  2  0   80   46   149 0.952   7.86
gagaacagctggttgcgctccaatcatgttacataacctacggcaaggtatcgacaggat
catactcctgtaaaatagaactttgttgatcacatcctgtgtacttgtttcacggacatg
aggagcaattacaacaggtcgtacaattatggcaaaataatggccttattttgtttttag
CTTCAGCGAGAACCCAGACCTTTCCCAAAGCTCAGGATTCTTCGAAAAGTTGAGAAAATT
GATGACTTCAAAGCTGAAGACTTTCAGATTGAAGGGTACAATCCGCATCCAACTATTAAA
ATGGAAATGGCTGTTTAG
ggtgctttcaaaggagctcgaaggatattgtcagtctttaggggttgggctggatgccga
ggtaaaagttctttttgctctaaaagaaaaaggaactaggtcaaaaatctgtccgtgacc
tatcagttattaatttttaaggatgttgccactggcaaatgtaactgtgccagttctttc

Predicted peptide sequence(s):


>TYMS_1|GENSCAN_predicted_peptide_1|152_aa
MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFG
MQARYSLRDAETEGPIRDVTGAGNTHSSDSREGSTNAKELSSKGVKIWDANGSRDFLDSL
GFSTREEGDLGPVYGFQWRHFGAEYRDMESVY

>TYMS_1|GENSCAN_predicted_peptide_2|756_aa
MDKFLDTYTLPRLNQEEVESLNRPITGAEIVAIINSLPTKKSPGPDGFTAEFYQRYKEEL
VPFLLKLFQSIEKEGILPNSFYEASIILIPKLGRDTTKKENFRPISLMNIDAKFLNKILA
NRIQQHIKKLIHHDHVGFIPGMQGWFNIHKSINVIQHINRSKDKNHMIISIDAEKAFDKI
QQHIMLKTLNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEAFPLKTGTRQGCPLSPLLF
NIVLEVLARAIRQEKEIKGIQLGKEEVKLSLFADDMIVYLENPIVSAQNLLKLISNFSKV
SGYKINLQKSQAFLYTNNRQTESQIMSELPLTIASKRIKYLGIHLKRDVKDLFKENYKPL
LNEIKEDTKKWKTIPCSWVGRINIVKMAILPKVIYRFNAIPIKLPMTFFTELEKTTLKFI
WNQKRAHIAKSILSQKNKAGDITLPDFKLYYKATVTKTVWYWYQNRHIDQWNRTEPSEIT
PHIYNYLIFDKPEKNKQWGKDSLFNKWCWENWLAICKKLKLDPFLTPYTKINSRWIKDLN
VRPKTIKTLEENLGITIQDIGMGKDFMSKTPKAMATKDKIDKWDLIKLKSFCTAKETTIR
VNRQPTKWEKIFATYSSDKELISRIYNELKQIYKKKTNNPIKKWAKDMNRHFSKEDIYAA
KKHMKKCSPSLAIREMQIKTTMRHHLTPVRMAIIKKSGNNRCWRGCGEIGTLLYCWWDCK
LVQPLWKSVWRFLRDLELEIPFDPALPLLGIYPKDY

>TYMS_1|GENSCAN_predicted_peptide_3|287_aa
MKTTGFFQPLGFQAHMMILLSSGSIKHVPDVRQPSPSPISITITITITITITISITITIS
ITITITISITITITITISITITITITITISIITITITITISITITITITITISITITITI
TISITITISITISITITISITITITISITIPSPSPSPSPSPSPSPSPSPSPSPSPSPSPS
PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPS
PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPELFRHP

>TYMS_1|GENSCAN_predicted_peptide_4|100_aa
MALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKLQREP
RPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV