GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:24:58

Sequence SERPINB4_1 : 9394 bp : 37.81% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1020   1087   68  0  2  123  113   -28 0.452   0.83
ttttgtttgtttgtttttgtttttgttttacagctggagtagaatacaaagggatggagt
tgaaacaaatgagaggaaattggaattctaaacttattctcattggcattagaaaggcac
ctacatgtatttcacatgagccggtgactgctgacttgcattcttattttttccctatag
ATTAAAAAGGAGGTACAATGGTAGAACTGTAATCCTGTCCTTTGTCATAAATTTTCATAT
TCATAAAG
gtgagtgttagcccgcttgtgaaatctgaagttgagtaacttcaaatactaaccacagag
ggaaaggcagcaagaggagaggcataaatttaggatctcacccttcattccacagacaca
cacagcctctctgcccacctctgcttcctctaggaacacaggtaagagcttcaagcctct

 1.02 Intr +   1854   2113  260  1  2   60   45   175 0.472   6.66
aggacattaatatatttaatatatgcacattgtagaaagattgaagcgttaaaaataaga
gaaaaactttaaatgtcaaaatctcacaacccagatatatcatttctttaagaaaattgt
actacaaaataccattccatttattaaagtcattctgacaggaatctgatgcttttccag
GAGTTCCAGATCACATCGAGTTCACCATGAATTCACTCAGTGAAGCCAACACCAAGTTCA
TGTTCGATCTGTTCCAACAGTTCAGAAAATCAAAAGAGAACAACATCTTCTATTCCCCTA
TCAGCATCACATCAGCATTAGGGATGGTCCTCTTAGGAGCCAAAGACAACACTGCACAAC
AAATTAGCAAGGTAGCTATCAGCATCATTACGTTGTCCTGTTGCAGTTTTTCTCTGGTTC
CGTCGGCTAGCACGCAGATG
gtaatagatgtggtggtctgatgggtagcacagggggctgtgcaggaattcccataactg
tgagaccactgacttaaacagatcttttgagtaaagttttcttgtcccgcttcatgtctc
ttccaggttcttcactttgatcaagtcacagagaacaccacagaaaaagctgcaacatat

 1.03 Intr +   2240   2296   57  1  0  100   84    54 0.953   4.36
attacgttgtcctgttgcagtttttctctggttccgtcggctagcacgcagatggtaata
gatgtggtggtctgatgggtagcacagggggctgtgcaggaattcccataactgtgagac
cactgacttaaacagatcttttgagtaaagttttcttgtcccgcttcatgtctcttccag
GTTCTTCACTTTGATCAAGTCACAGAGAACACCACAGAAAAAGCTGCAACATATCAT
gtgagtcacagagcactatggttcagctttagatccctgaacaggtcatagtttaaacct
ggaacttcacaaaaactaagaaaaggccagttttagggaaaatcttggacacaaagattg
agacatacagagtgggttggcatttcatggcacataattattattcctcatttctgcgtt

 1.04 Intr +   3569   3697  129  1  0   54   91    76 0.935   4.47
gtcaaatataaggtggattttgaagggtatttgaggtgaaatacaccaattatcagggaa
taacatcaaaggtcctcaatgagactaccagcatttagggactgatctaacagacttagc
atgggtttagtatttacattgatacagcaattgaatgatctccctttttgatgtttgaag
GTTGATAGGTCAGGAAATGTTCATCACCAGTTTCAAAAGCTTCTGACTGAATTCAACAAA
TCCACTGATGCATATGAGCTGAAGATCGCCAACAAGCTCTTCGGAGAAAAGACGTATCAA
TTTTTACAG
gtaatttcacctggcctacccacatttcatttgcatcctgatgtctgtgtctctgagtgg
ccaaatggaagaaagcaaggcagatgagcctggccgactcaggtggagagcatttactca
gagtgcattagctccatttccacaactctcccccactggagtgtcccagaccccaacgat

 1.05 Intr +   4466   4583  118  1  1   62   58   170 0.969  10.52
agcccacattccccttttgcattgcctacatgacacctgtataaaaatatccatggacag
gagatactgcatctattcagggtctggattcagcttactgttgttacaaataagtaagtt
tggtaatatatagttacataaattactcctaattcctacttcttccttcatatctcaaag
GAATATTTAGATGCCATCAAGAAATTTTACCAGACCAGTGTGGAATCTACTGATTTTGCA
AATGCTCCAGAAGAAAGTCGAAAGAAGATTAACTCCTGGGTGGAAAGTCAAACGAATG
gtaggagagccacccattatagaaacacctttgagaaacctatgccagtgagccttgtgc
ttgacactgcatgggggaacaggtgtggggattgagatgggtttgcagggagggctgaag
agggcactccagatgaaggatttgtccaaatgaatatgaagagagcctaggggagccaag

 1.06 Intr +   5681   5823  143  0  2  117   67    56 0.967   5.55
gaaagctgcatctggtgaaccactggtcagtgagtctaacaattcaaagatcaaagtcag
tgagtctcaagcagggatttgggtcaataattaacgatcagtcacgaacatttgcaaagc
atcttccagacaagccatttgtagcttgtgtaaaagactcttttattctttcccttgcag
AAAAAATTAAAAACCTATTTCCTGATGGGACTATTGGCAATGATACGACACTGGTTCTTG
TGAACGCAATCTATTTCAAAGGGCAGTGGGAGAATAAATTTAAAAAAGAAAACACTAAAG
AGGAAAAATTTTGGCCAAACAAG
gtattgtctatattttatttatatagtgtaatatgttaatacatggaatgttaaacattt
ctgatggaatgtaacatgataagtaaaaaataaaaattgttcatgtctgttattttgttg
ttttactcttataactttatttagttaggaatacctgaaaaactattgtttctaactcat

 1.07 Intr +   6117   6272  156  2  0   35  116   126 0.960   9.39
tttgttgttttactcttataactttatttagttaggaatacctgaaaaactattgtttct
aactcatggaattcctgggttatttcttagaagaagaaggatgtgttgctatctcaataa
tattatcttttttgtcttgtgtttcacgtgttatttgttggacacattgatttattgcag
AATACATACAAATCTGTACAGATGATGAGGCAATACAATTCCTTTAATTTTGCCTTGCTG
GAGGATGTACAGGCCAAGGTCCTGGAAATACCATACAAAGGCAAAGATCTAAGCATGATT
GTGCTGCTGCCAAATGAAATCGATGGTCTGCAGAAG
gtaagaacttgcatctacaactcttccttctactgccggacatttttccaaagataccaa
gtttaaacaaggtaaaagcttatgaccgagttgcctcaaaatgatgaaaaattctaaatg
aggaatgatgactcaccttcatattacaaatatttgagcatagggcctgacacaaactga

 1.08 Term +   7334   7738  405  1  0   55   37   280 0.993  13.80
atgtatttatatattcaggactcatattttacctattagaataataatgtctattaaagt
gaaccttctgtatttcacatttattgccaaaataacgaatctccacatagtcaattcatt
gttaaggtgtattagagatcgacagttagtcatatcagtttcttttttccatttgtatag
CTTGAAGAGAAACTCACTGCTGAGAAATTGATGGAATGGACAAGTTTGCAGAATATGAGA
GAGACATGTGTCGATTTACACTTACCTCGGTTCAAAATGGAAGAGAGCTATGACCTCAAG
GACACGTTGAGAACCATGGGAATGGTGAATATCTTCAATGGGGATGCAGACCTCTCAGGC
ATGACCTGGAGCCACGGTCTCTCAGTATCTAAAGTCCTACACAAGGCCTTTGTGGAGGTC
ACTGAGGAGGGAGTGGAAGCTGCAGCTGCCACCGCTGTAGTAGTAGTCGAATTATCATCT
CCTTCAACTAATGAAGAGTTCTGTTGTAATCACCCTTTCCTATTCTTCATAAGGCAAAAT
AAGACCAACAGCATCCTCTTCTATGGCAGATTCTCATCCCCATAG
atgcaattagtctgtcactccatttagaaaatgttcacctagaggtgttctggtaaactg
attgctggcaacaacagattctcttggctcatatttcttttctatctcatcttgatgatg
atagtcatcatcaagaatttaatgattaaaatagcatgcctttctctctttctcttaata

Predicted peptide sequence(s):


>SERPINB4_1|GENSCAN_predicted_peptide_1|445_aa
XLKRRYNGRTVILSFVINFHIHKGVPDHIEFTMNSLSEANTKFMFDLFQQFRKSKENNIF
YSPISITSALGMVLLGAKDNTAQQISKVAISIITLSCCSFSLVPSASTQMVLHFDQVTEN
TTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKK
FYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQ
WENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIV
LLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMV
NIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCC
NHPFLFFIRQNKTNSILFYGRFSSP