GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:25:22

Sequence SERPINB2_1 : 18578 bp : 38.75% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   4929   5105  177  2  0  121  113   121 0.850  17.09
ggctgcacaggtggtatgtccatgaagctgtccctgacctgcctcatgttgttccatgag
gaagaacagacagggaatctgtccctacacagaatgcagcctgtcctactgttgctgacc
tcacccaaaatgttaccttatgtttcagagctgtttttttcttcctctctttgcttctag
ATTGAAACAATGGAGGATCTTTGTGTGGCAAACACACTCTTTGCCCTCAATTTATTCAAG
CATCTGGCAAAAGCAAGCCCCACCCAGAACCTCTTCCTCTCCCCATGGAGCATCTCGTCC
ACCATGGCCATGGTCTACATGGGCTCCAGGGGCAGCACCGAAGACCAGATGGCCAAG
gtgagtttgagctgaagctccacatttgggccgagtagttcctgaatggaattggagaac
tgctcttgttttatgctaaagacattttaactcaggaggtcagcaatcatcacaggtaat
gaagcactgatccttacaacacaaattccttagattcaaatctataagacagccaagccc

 1.02 Intr +   8757   8876  120  2  0   84   70   134 0.981  10.97
ttaggttggctgatacttttatattacacagaaagagtattgagtatctatggttgttcc
ccatgtataagggaagggaaaagatctaggaccattttagagccacctgatagccatctg
ttttaaaagttcagtaaatccgtgggcaagtgtaaccgttttctctaattctgattgcag
GTGCTTCAGTTTAATGAAGTGGGAGCCAATGCAGTTACCCCCATGACTCCAGAGAACTTT
ACCAGCTGTGGGTTCATGCAGCAGATCCAGAAGGGTAGTTATCCTGATGCGATTTTGCAG

gtatctgacttactggtccaaatttcttttgtggtttatttttgcaatcttcctgtctta
aagccacagtgtcagactgggaaggaagcgaatataccctcccccattcacagaaagaaa
actaagactcagagtcattaagaaaaacatgtcctaagatgatacccataacgagagacg

 1.03 Intr +  10584  10712  129  2  0   75  100    88 0.996   8.67
tttaatgtaccacatccttatcgaaatgattttctcaaagattcctctaatgtaccaaaa
ataaagtatgtattaatatagcatttcatgattgtattcaaaaactattaccatggctta
agaactatcttgtttagtagttctgtgttatatataaagaattccttctttcttttcaag
GCACAAGCTGCAGATAAAATCCATTCATCCTTCCGCTCTCTCAGCTCTGCAATCAATGCA
TCCACAGGGAATTATTTACTGGAAAGTGTCAATAAGCTGTTTGGTGAGAAGTCTGCGAGC
TTCCGGGAA
gtaagtgaaacctgtaattgaaatggctggatcccaaacaagtaatgaagtcactttcaa
agcagttctctacaattcaacagttcataaaagcagagttggaattccacaccagctccc
tagggctggccttgcgtaacagctgcccttcctgtaccctctggggcttcctcctcttcc

 1.04 Intr +  11220  11337  118  2  1   73   94    74 0.996   5.62
taagcgtggacaaaggggtctgcactctttcccccttcagcacctgccttccatagccaa
cctccactcccaccctaccccaggtctcctaatttcaatgggaagaccataattcaccat
tatgccatggcttgtttggtatgtattttatgtagcctttgtcattttcttgctttaaag
GAATATATTCGACTCTGTCAGAAATATTACTCCTCAGAACCCCAGGCAGTAGACTTCCTA
GAATGTGCAGAAGAAGCTAGAAAAAAGATTAATTCCTGGGTCAAGACTCAAACCAAAG
gtaaatccaagaaaatattttatttacttctttccagttagaaaactctgatctatcttt
ttccatccatgaacttagttagccctcacccctttacaatttgtccaactgcagttactt
tggtggatgtgaatttattcctgattagctcagtggtgttttaactgagaagaaataatt

 1.05 Intr +  15233  15375  143  0  2   76   68   149 0.996  10.85
aagcttttgggaaatttgtttcaattttaattttgctttaaataaacctaaaaaacttta
gcttgaagattaacaactctgcaatttgaagaatttagtttgatggctactcagaagatt
cagtaagtaatttcacagttcttgattatgaaacctaaatatatgttatgttttctgtag
GCAAAATCCCAAACTTGTTACCTGAAGGTTCTGTAGATGGGGATACCAGGATGGTCCTGG
TGAATGCTGTCTACTTCAAAGGAAAGTGGAAAACTCCATTTGAGAAGAAACTAAATGGGC
TTTATCCTTTCCGTGTAAACTCG
gtatgagacaacaaaatacatcttcctagcatatattttagggcttttgacaagatatag
acagaaaaattagagaccgctcattatagacttgctagttagaagttatgcatgttggac
agttgattgactctttagaaacagtataggtaaaggggaagactgtggctttttaattat

 1.06 Intr +  15897  16061  165  2  0   29   99   211 0.948  15.54
ttgaacaagctaataacatcagagtacccactgtaaggatgtacaaataatttattttgt
tgatttaaaaaaatcacatttatcctacactaaagtagaaccaatcctcctttatgtcta
attgtaaatctcttgatatcttataatcgacttccatattttaccttttaataatattag
GCTCAGCGCACACCTGTACAGATGATGTACTTGCGTGAAAAGCTAAACATTGGATACATA
GAAGACCTAAAGGCTCAGATTCTAGAACTCCCATATGCTGGAGATGTTAGCATGTTCTTG
TTGCTTCCAGATGAAATTGCCGATGTGTCCACTGGCTTGGAGCTG
gtaagacattcagatatttaagtttctggggctatacctacctttcgtgagatgagatga
atatatactccttacaaatggtgtggtaatttctcatggaaatatatgaaacagttgata
gtaaatatggcatgcctctacatttcattcaaagccttaactatgtcatacgtgttacct

 1.07 Term +  16394  16798  405  1  0  103   41   316 0.937  22.60
agccttaactatgtcatacgtgttaccttcttgtaaaaatctgaccaatctgttaacttt
ctatatcacccacaatatagtaaagtcactgatttttaatattagacttaaagttgtttt
ccttctttctaatacttgctgtattttcttttgtttgttttgttttgttttgctttgcag
CTGGAAAGTGAAATAACCTATGACAAACTCAACAAGTGGACCAGCAAAGACAAAATGGCT
GAAGATGAAGTTGAGGTATACATACCCCAGTTCAAATTAGAAGAGCATTATGAACTCAGA
TCCATTCTGAGAAGCATGGGCATGGAGGACGCCTTCAACAAGGGACGGGCCAATTTCTCA
GGGATGTCGGAGAGGAATGACCTGTTTCTTTCTGAAGTGTTCCACCAAGCCATGGTGGAT
GTGAATGAGGAGGGCACTGAAGCAGCCGCTGGCACAGGAGGTGTTATGACAGGGAGAACT
GGACATGGAGGCCCACAGTTTGTGGCAGATCATCCTTTTCTTTTTCTTATTATGCATAAG
ATAACCAACTGCATTTTATTTTTCGGCAGATTTTCCTCACCCTAA
aactaagcgtgctgcttctgcaaaagatttttgtagatgagctgtgtgcctcagaattgc
tatttcaaattgccaaaaatttagagatgttttctacatatttctgctcttctgaacaac
ttctgctacccactaaataaaaacacagaaataattagacaattgtctattataacatga

Predicted peptide sequence(s):


>SERPINB2_1|GENSCAN_predicted_peptide_1|418_aa
IETMEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKV
LQFNEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINAS
TGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQT
KGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYL
REKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSK
DKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQ
AMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP