GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:15:08

Sequence POLI_1 : 27567 bp : 36.31% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1193   1358  166  1  1   91   35   300 0.851  24.84
aaaaactcccgcacgtgggcctccacgattccttggcatgcgtgtcactctgggcaacag
gctggtcggccacgactgcgcaggcgagaggcacagagcgactggagactgtagtccccc
ggtttccctggagaccaggcggaagcggccggaagtagcgctgcggttggcagcggcggg
ATGGAGAAGCTGGGGGTGGAGCCGGAGGAGGAAGGCGGCGGCGACGACGACGAGGAAGAC
GCCGAGGCCTGGGCCATGGAACTGGCGGACGTGGGGGCGGCAGCCAGCTCGCAGGGTGCG
CCGCAGCCAGAGGAGCCAGCGGCCTCCTTGGGTGTAAATGAGAAGG
gtggggcaggcggacgctcggggcggcggccactggggcgcgaccgtccccgccccactc
ggctcctctaagagagggctgcctccctctgccttgtgttacgcggcgggtacctctaga
ggaatggcttcacccagcaggagtagggtggggcgcgtccacactacaaatacgtgtcga

 1.02 Intr +   3006   3131  126  1  0   75   61    64 0.807   2.13
gaccctaccctaagtggagtttcatgtctttgtaatttttcgatgctttcacacataatc
caggagaaaacacgtcactctgcattcttccttcacaggtaccatgttttaaggaactgt
cagttgctcagagataataagcagcctgaatttctttttatttctttgcatattgtgcag
GAGTTCATGATCAAGTGTTGCCCACACCAAATGCTTCATCCAGAGTCATAGTACATGTGG
ATCTGGATTGCTTTTATGCACAAGTAGAAATGATCTCAAATCCAGAGCTAAAAGACAAAC
CTTTAG
gtaactgtagatttataatatttttaattgcataatgattagattagcaactcatcatgc
tcattatatactgatttattaaccttattaagaaagattttggaagcagttcttacagtg
ctttatagctggtcatttttgcttcactaccaagtgtaaattttacaagcctcatttaat

 1.03 Intr +   5572   5736  165  2  0   52   87   150 0.993  10.31
aatgtttctgcattatagagatttgatatatggaggctatgttttttaattgagacaggg
cttttgattcttatcaaaactgattgtcttacaatttagacaaatgtaatacggaattaa
taatatctttaaatgttttcttcaattgtgcttgggtttctcataaaatattttttacag
GGGTTCAACAGAAATATTTGGTGGTTACCTGCAACTATGAAGCTAGGAAACTTGGAGTTA
AGAAACTTATGAATGTCAGAGATGCAAAAGAAAAGTGTCCACAGTTGGTATTAGTTAATG
GAGAAGACCTGACCCGCTACAGAGAAATGTCTTATAAGGTTACAG
gtacaaatgataagcaatgtacttttagcattaatttttatgtaggatgcctgttcatta
catgaattttttaataaatgtaaaataacataagtcaagatgctttttcctaataacttc
ttattttgggtcttgtcaactttaaaaattatgtgaaaggataactgtatgctatgaata

 1.04 Intr +   9349   9501  153  2  0   42   65   206 0.961  12.82
acaagatgtggtacagaaaaaacgtcaattaactgagggctttattaaagatattatgga
actatgaatgtatataaaacctttaacaataaatttgataaatttttaagcactagatag
ttaaatttatcctagttataacttcatttacatttgtgctccaatattatttcaatttag
AATTACTGGAAGAATTTAGTCCAGTTGTTGAGAGACTTGGATTTGATGAAAATTTTGTGG
ATCTAACAGAAATGGTTGAGAAGAGACTACAGCAGCTGCAAAGTGATGAACTTTCTGCGG
TGACTGTGTCGGGTCATGTATACAATAATCAGT
gtgagtgggttcttattcattctacctactaaccaaaagtacatacatttcttaatgttc
agtgagttcgctgtgtgattctgaaagattcatgacttttgttggaggtatagttatatt
tagtcagtaatctgtctaggacagctaaaattaggtgctgctattccataataagtgtta

 1.05 Intr +  12313  12549  237  2  0   66   99   113 0.967   6.86
caaattacaacatgaggtttggaggggacaaatatcacaaccataccaggtgatgatggt
ggtggttgtggtggtggtggttgttggatatagactaagccctctaccttttaaaaatta
ttttgtgaaaaagaaaaaggtttttcttgtgactttgaatgacatttgttgtttttaaag
CTATAAACCTGCTTGACGTCTTGCACATCAGACTACTTGTTGGATCTCAGATTGCAGCAG
AGATGCGGGAAGCCATGTATAATCAGTTGGGGCTCACTGGCTGTGCTGGAGTGGCTTCTA
ATAAACTGTTGGCAAAATTAGTTTCTGGTGTCTTTAAACCAAATCAACAAACAGTCTTAT
TACCTGAAAGTTGTCAACATCTTATTCATAGTTTGAATCACATAAAGGAAATACCTG
gtaagacaaatatatttgaaaagtacatatacgtcttattttatttcttttaatttaaaa
aattatagatacaatgtaattaattcttaggtagagttgtctgtgagtttgtgtgcatgt
gtgtgtgtgtgtatacttggttcctggaaaaaactaagaaaaactgtaatgttttctcaa

 1.06 Intr +  14483  14661  179  0  2   73   88   141 0.997  11.32
tactgtccatggtttcaggcatccactgaaggtcttagaatgtatcccctgtggataagg
ggggactactgtataaattatagaacttaaagataagattgatatatttataatatttta
attagctttgttttaaggagaaaagctattttaacattgtatgcatttctttttatttag
GTATTGGCTATAAAACTGCCAAATGTCTTGAAGCACTGGGTATCAATAGTGTGCGTGATC
TCCAAACCTTTTCACCCAAAATTTTAGAAAAAGAATTAGGAATTTCAGTTGCTCAGCGTA
TCCAAAAGCTCAGTTTTGGAGAGGATAACTCCCCTGTGATACTCTCAGGACCACCTCAG
gtacatgatgatacttattttaattaagtactggttatcacattatttgagataaagatt
tctagttttagtaccatgttcttactattctagtttgcttagtatgtgatccctttccta
ttagaaggctgatttattattaatagattggattaataagtattcttaaatggaatctta

 1.07 Intr +  15568  15659   92  0  2   50   60    83 0.994  -0.43
gtgagtacaatagcttgcagataaaaaactgttaatataaaagtgaactaaatggctcaa
actaaggacaagaggtaagttagtgaagaatgtattgaatatttatttgactgtacactg
ataataattagatatagttatttgagtttgtgctaatccttatttatgcttctttgatag
TCCTTTAGTGAAGAAGATTCATTTAAAAAATGTTCATCTGAAGTTGAAGCTAAAAATAAG
ATTGAAGAACTACTTGCTAGTCTTTTAAACAG
gtgattttcaatccattttgccaagtcatcctatgtattcattctatatacggtatgtgg
aaagaatatttgatgttccatcttggaactgacagattatctggagactaaacaatgtaa
aaataatttatcatgggatttctctgctttataaactgttgtaaagatggtaataggggg

 1.08 Intr +  18927  19057  131  0  2  102   80   103 0.990  10.32
agactttgtgatgattatttggatactcagggacctttattgcttactattttgttatct
gctatatgtataattgtcatatttaacaaaatctggcacctttagataaatgagatgtta
cataatttaaaaaggtaatacttttctaattccttatttccactttctctttatttttag
AGTATGCCAAGATGGAAGGAAGCCTCATACAGTGAGATTAATAATCCGTCGGTATTCCTC
TGAGAAGCACTATGGTCGTGAGAGTCGTCAGTGCCCTATTCCTTCACATGTAATTCAGAA
ATTAGGGACAG
gtatggactagttttccaacagtttcattagcaggttgaactcttaaataagccaacttt
gaatgagaaatatgctccaaaaatggagggtcttcacagggaattagcaagcaattaaat
gcttttattctatcaggaattttcactggaaaactttgttgtttgtttatttatttattt

 1.09 Intr +  23479  23684  206  2  2   59   78   110 0.988   5.10
tatttcaaatcttttgaaaatttttaaccatttagtattaatattgaaatgtcttaattt
ggtatataatgtcaagatgcccagtgatatttaggattttaatttcttaatctcagcaat
ataaaatatattatgctcttaatattaattataatgtttattcttaaacattttatttag
GAAATTATGATGTGATGACCCCAATGGTTGATATACTTATGAAACTTTTTCGAAATATGG
TGAATGTGAAGATGCCATTTCACCTTACCCTTCTAAGTGTGTGCTTCTGCAACCTTAAAG
CACTAAATACTGCTAAGAAAGGGCTTATTGATTATTATTTAATGCCATCATTATCAACTA
CTTCACGCTCTGGCAAGCACAGTTTT
gtaagtacactcttttttgttcagttttctaagtatactcttatgggatttgtgtggtta
cattacaaatctaagtgcttgtctttttgatatagtttagagattcttttgggtgatatt
gtttaggtgattaacttgtttataatacctatcttatggtttctggccttaaatatgctg

 1.10 Term +  25295  26113  819  1  0   93   47   507 0.999  39.22
cacaaaatagtgtgaataattgtggtagtagatctctagttgtttggaactggccacaaa
gagttgtatttgttgagtaggttagaaacatgtcagataatagctacaggcacacagcag
cagcagcgatatttaaaagatatcagatatgtaaattagtctgttattcttgtgttctag
AAAATGAAAGACACTCATATGGAAGATTTTCCCAAAGACAAAGAAACAAACCGGGATTTC
CTACCAAGTGGAAGAATTGAAAGTACAAGAACTAGGGAGTCTCCACTAGATACCACAAAT
TTTTCTAAAGAAAAAGACATTAATGAATTCCCACTCTGTTCACTTCCTGAAGGTGTTGAC
CAAGAAGTCTTCAAGCAGCTTCCAGTAGATATTCAAGAAGAAATCCTTTCTGGAAAATCT
AGGGAAAAATTTCAAGGGAAAGGAAGTGTGAGTTGTCCATTACATGCCTCTAGAGGAGTA
TTATCTTTCTTTTCTAAAAAACAAATGCAAGATATTCCCATAAATCCTAGAGATCATTTA
TCCAGTAGCAAACAGGTATCCTCTGTATCTCCTTGTGAACCGGGAACATCAGGCTTTAAT
AGCAGTAGTTCTTCTTACATGTCTAGCCAAAAGGATTATTCATATTATTTAGATAATAGA
TTAAAAGATGAACGAATAAGTCAAGGACCTAAAGAACCTCAAGGATTCCACTTTACAAAT
TCAAACCCTGCTGTGTCTGCTTTTCATTCATTTCCAAACTTGCAGAGTGAGCAACTTTTC
TCCAGAAACCACACTACAGATAGCCATAAGCAAACAGTAGCAACAGACTCTCATGAAGGA
CTTACAGAAAATAGAGAGCCAGATTCTGTTGATGAGAAAATTACTTTCCCTTCTGACATT
GATCCTCAAGTTTTCTATGAACTACCAGAAGCAGTACAAAAGGAACTGCTGGCAGAGTGG
AAGAGAGCAGGATCAGATTTCCACATTGGACATAAATAA
gcatattcagcaaaaaggtctgaaaagcaagggaataccattattttcggattagcggtt
tattaagctcttctatattaaacactaatagatattcaataacggagtaaactgttccag
ataaagcaagaatagttgcaagaagtaaattctggcacaaagcgtaaaaatataacagaa

Predicted peptide sequence(s):


>POLI_1|GENSCAN_predicted_peptide_1|757_aa
MEKLGVEPEEEGGGDDDEEDAEAWAMELADVGAAASSQGAPQPEEPAASLGVNEKGVHDQ
VLPTPNASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKL
MNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEK
RLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAG
VASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSV
RDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAK
NKIEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYD
VMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLKALNTAKKGLIDYYLMPSLSTTSRS
GKHSFKMKDTHMEDFPKDKETNRDFLPSGRIESTRTRESPLDTTNFSKEKDINEFPLCSL
PEGVDQEVFKQLPVDIQEEILSGKSREKFQGKGSVSCPLHASRGVLSFFSKKQMQDIPIN
PRDHLSSSKQVSSVSPCEPGTSGFNSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQG
FHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKIT
FPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK