GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:12:56

Sequence MBD1_1 : 15030 bp : 50.31% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2660   2794  135  2  0  117   69   188 0.945  19.48
aataggaaagaatggggtgagaatatgaggggtttcttttccatatatgggctggttgcc
tgtggcaggtcctagggcttgggcaagcactaatggataccagtgatttgtgtggcctgg
ggcacagtgttgtcccttcctagagcctcagtttccctcatcccttccaccccctttcag
GCTACTGCTGCTTCCTGTGGCCTCCATGGCTGAGGACTGGCTGGACTGCCCGGCCCTGGG
CCCTGGCTGGAAGCGCCGCGAAGTCTTTCGCAAGTCAGGGGCCACCTGTGGACGCTCAGA
CACCTATTACCAGAG
gtactgggtgggtagtgggcagagtcaggagtggggtagagcctgattctggtaaaatca
aatggtgtggttaaatttatggatgaagtttaaattatgcacatacagttaatccttatt
agcggattttatgtttgaatttcacctacttaataaaatttatttgtaacttaaaagtca

 1.02 Intr +   5473   5587  115  1  1   52   75   112 0.961   6.75
atgtgttggtatttatattaatttttttatgttttcaaggttagttgaggtgggggctgg
gcagggctcacaagccaattccaggctgcctcctatatcctgccagccctgtcaaaaggt
tgtatgagtgaaatggcattggctccacctgggtgctaacccatcatggcccatccctag
CCCCACAGGAGACAGGATCCGAAGCAAAGTTGAGCTGACTCGATACCTGGGCCCTGCGTG
TGATCTCACCCTCTTCGACTTCAAACAAGGCATCTTGTGCTATCCAGCCCCCAAG
gtacttcacaacatgagatacctaggtaggggtggatgtgccacccaacacccaaccact
gacccatattcctccttcccttactttccaggcccatcccgtggcggttgccagcaagaa
gcgaaagaagccttcaaggccagccaagactcggaaacgtcaggttggaccccagagtgg

 1.03 Intr +   5679   5845  167  2  2  111   92    99 0.977  11.36
aagttgagctgactcgatacctgggccctgcgtgtgatctcaccctcttcgacttcaaac
aaggcatcttgtgctatccagcccccaaggtacttcacaacatgagatacctaggtaggg
gtggatgtgccacccaacacccaaccactgacccatattcctccttcccttactttccag
GCCCATCCCGTGGCGGTTGCCAGCAAGAAGCGAAAGAAGCCTTCAAGGCCAGCCAAGACT
CGGAAACGTCAGGTTGGACCCCAGAGTGGTGAGGTCAGGAAGGAGGCCCCGAGGGATGAG
ACCAAGGCTGACACTGACACAGCCCCAGCTTCATTCCCTGCTCCTGG
gtgagtgttggtctaaggtgagccagatgggtgagggttgtgattgggggtgctcttgga
gccccacacctgcctttcccatcccaggtgctgtgagaactgtggaatcagcttctcagg
ggatggcacccaaaggcagcggctcaaaacgttgtgcaaagactgtcgaggtgagtggcc

 1.04 Intr +   5933   6015   83  2  2  102  105    42 0.990   6.58
tggaccccagagtggtgaggtcaggaaggaggccccgagggatgagaccaaggctgacac
tgacacagccccagcttcattccctgctcctgggtgagtgttggtctaaggtgagccaga
tgggtgagggttgtgattgggggtgctcttggagccccacacctgcctttcccatcccag
GTGCTGTGAGAACTGTGGAATCAGCTTCTCAGGGGATGGCACCCAAAGGCAGCGGCTCAA
AACGTTGTGCAAAGACTGTCGAG
gtgagtggcctccagaggatggggcatcgggagataggagctggagcaggtccagtgtca
tgctaggctggggtttgaatgtggatgtcaggacagaggctactggcatggttggaggtt
ggatattggagatagcaggcataggtagaggttgaatagtggaagtcagggcacaggcag

 1.05 Intr +   6259   6426  168  2  0  131   48   108 0.439  11.02
taggctggggtttgaatgtggatgtcaggacagaggctactggcatggttggaggttgga
tattggagatagcaggcataggtagaggttgaatagtggaagtcagggcacaggcagtga
gtgaagtcagatgtctgttgcttcctttccacttttcttcttccctcttcctccccacag
CACAGAGAATTGCCTTCAACCGGGAACAGAGAATGTTTAAGGTAAGCACAACCTGCTTCC
TCTTCACAACTCTGCAGTGGGAGCAGGATGTGATGGAGCTGGTAGAGTCTGAAGGGATGA
TGATGGGTCCACAGGATGAAGAGTCATTTTATAGGGTGCTCTCCATAG
gtcagcagacacaataatgggaattaatggggtaattaatccccattaccattagtgcat
cagtagacacagtgatgaagtgaacaggggaccagtagacatactaatggcctcagtgat
ggtgactaaccagaccttctcagatacggtgatgaggctaatgggggactaaaattcatg

 1.06 Intr +   6560   6728  169  0  1    4   92    68 0.429  -2.20
gatgggtccacaggatgaagagtcattttatagggtgctctccataggtcagcagacaca
ataatgggaattaatggggtaattaatccccattaccattagtgcatcagtagacacagt
gatgaagtgaacaggggaccagtagacatactaatggcctcagtgatggtgactaaccag
ACCTTCTCAGATACGGTGATGAGGCTAATGGGGGACTAAAATTCATGGTGATGCCAGCTG
ATGTAGGGTCAGTAGACATGGGAGGACCAGTGCTTCTGGAGCAGGCCCGTGATCTCGTCC
CTACCATTCCTGGCAGCGTGTGGGCTGTGGGGAGTGTGCAGCCTGCCAG
gtaacagaagactgtggggcctgctccacctgcctcctgcagctgccccatgatgtggca
tcggggctgttctgcaagtgtgaacggagacgctgcctccggattgtggaaagggtgagt
tgggcaagtggaaagagcccaaggctcacctcggcccctggcccccatgggcttggcccc

 1.07 Intr +   6771   6842   72  0  0   88   96    29 0.448   2.22
gggactaaaattcatggtgatgccagctgatgtagggtcagtagacatgggaggaccagt
gcttctggagcaggcccgtgatctcgtccctaccattcctggcagcgtgtgggctgtggg
gagtgtgcagcctgccaggtaacagaagactgtggggcctgctccacctgcctcctgcag
CTGCCCCATGATGTGGCATCGGGGCTGTTCTGCAAGTGTGAACGGAGACGCTGCCTCCGG
ATTGTGGAAAGG
gtgagttgggcaagtggaaagagcccaaggctcacctcggcccctggcccccatgggctt
ggccccatgcttcatgcctctgctcccacctgccccccgccaacagagccgagggtgtgg
agtatgccggggctgtcagacccaagaggattgtggccattgccccatctgccttcgccc

 1.08 Intr +   6949   7077  129  1  0   82  100   147 0.551  15.11
agctgccccatgatgtggcatcggggctgttctgcaagtgtgaacggagacgctgcctcc
ggattgtggaaagggtgagttgggcaagtggaaagagcccaaggctcacctcggcccctg
gcccccatgggcttggccccatgcttcatgcctctgctcccacctgccccccgccaacag
AGCCGAGGGTGTGGAGTATGCCGGGGCTGTCAGACCCAAGAGGATTGTGGCCATTGCCCC
ATCTGCCTTCGCCCTCCCCGCCCTGGTCTCAGGCGCCAGTGGAAATGTGTCCAGCGACGT
TGCCTACGG
gtgagttgggctggagggagcagagctcattctgctgttaaaatcgtcgctgcctctgct
tcctttcaacctggccttgcctacctcatgtctttcttttctgcctaaccctatgctcgc
ctttctggccccgcctacctgcctctgtctgccagcaccttgctcaccgcctgcgtcgcc

 1.09 Intr +   7233   7307   75  0  0   64   74    72 0.443   2.03
atgtgtccagcgacgttgcctacgggtgagttgggctggagggagcagagctcattctgc
tgttaaaatcgtcgctgcctctgcttcctttcaacctggccttgcctacctcatgtcttt
cttttctgcctaaccctatgctcgcctttctggccccgcctacctgcctctgtctgccag
CACCTTGCTCACCGCCTGCGTCGCCGTCATCAGAGATGTCAGCGACGCACTCCCCTGGCT
GTGGCTCCCCCAACT
gtgagtgcctcacgccaccctctgtctgcctgtcccatgcatgctttctgcacttagggt
gtggggagtttctgtgtctgcctggtgccaccaagctgaaaccaccctttctgatctttc
ccagggtaaacatgcccgccgcaagggaggctgtgactccaagatggctgccaggcggcg

 1.10 Intr +   7365   7548  184  0  1   71   93    14 0.554  -0.01
accctatgctcgcctttctggccccgcctacctgcctctgtctgccagcaccttgctcac
cgcctgcgtcgccgtcatcagagatgtcagcgacgcactcccctggctgtggctccccca
actgtgagtgcctcacgccaccctctgtctgcctgtcccatgcatgctttctgcacttag
GGTGTGGGGAGTTTCTGTGTCTGCCTGGTGCCACCAAGCTGAAACCACCCTTTCTGATCT
TTCCCAGGGTAAACATGCCCGCCGCAAGGGAGGCTGTGACTCCAAGATGGCTGCCAGGCG
GCGCCCCGGAGCCCAGCCACTGCCTCCACCACCCCCATCACAGTCCCCAGAGCCCACAGA
GCCG
gtgaggccccagtgggtggagggaaggcacaaccctgaccttacccagtacctgccctga
ccccaccccatttgcctctacagcaccccagagccctggccccctcgccacctgccgagt
tcatctattactgtgtagacgaggacgagctagtgagtggccccaccctacctggataag

 1.11 Intr +   7632   7700   69  2  0  111   75    88 0.997   9.18
gggaggctgtgactccaagatggctgccaggcggcgccccggagcccagccactgcctcc
accacccccatcacagtccccagagcccacagagccggtgaggccccagtgggtggaggg
aaggcacaaccctgaccttacccagtacctgccctgaccccaccccatttgcctctacag
CACCCCAGAGCCCTGGCCCCCTCGCCACCTGCCGAGTTCATCTATTACTGTGTAGACGAG
GACGAGCTA
gtgagtggccccaccctacctggataagcctagaatctcaggacgcttggttaacttcaa
agaagcagatgctggaatgagcctattggggaacagcaaggcacaataatgggtcctagg
atgggatgagtagataatggaggactaatacggggtcagcaggtgcatgagagtgcttca

 1.12 Intr +   8324   8491  168  1  0   69   64   358 0.942  31.64
gccaatgttgaactagcgaatgctgaggagtgactagtggggagtcaggaggctgagact
agtatgcaagtagctccgtcttatggggctagaggagcaccaggaccagcactggaatag
gcgttgaggatggcctctcctagtcctagttgacagcaccacccattccccccaccccag
CAGCCCTACACGAACCGCCGGCAGAACCGCAAGTGCGGGGCCTGTGCAGCCTGCCTACGG
CGGATGGACTGTGGCCGCTGCGACTTCTGCTGCGACAAGCCCAAATTCGGGGGCAGCAAC
CAGAAGCGCCAGAAGTGTCGTTGGCGCCAATGCCTGCAGTTTGCCATG
gtgggtggggcaggaagggtcaggtggacgggataggttgggccaggcgccccagtgcct
ggaagtggtgggcaggcttggtaggtgggtgggtggggcagtagctttggttgaggatta
acagacattgttcttggcttaatgagtctaggtggcattggtgttgctaataggagacta

 1.13 Intr +   8814   9113  300  2  0   72   94   166 0.977  12.53
tgagtctaggtggcattggtgttgctaataggagactagcaggctcagtgatgaagggct
catatgtaagcagattccgtgctgggactgatgggagattagcaggcatgtggagccggg
cagggtggatgtgattggtcaggacaccaggtagccatagcaccctatctttccccatag
AAGCGGCTGCTGCCCAGTGTCTGGTCAGAGTCTGAGGATGGGGCAGGATCGCCCCCACCT
TACCGTCGTCGAAAGAGGCCCAGCTCTGCCCGACGGCACCATCTTGGCCCTACCTTGAAG
CCCACCTTGGCTACACGCACAGCCCAACCAGACCATACCCAGGCTCCAACGAAGCAGGAA
GCAGGTGGTGGCTTTGTGCTGCCCCCGCCTGGCACTGACCTTGTGTTTTTACGGGAAGGC
GCAAGCAGTCCTGTGCAGGTGCCGGGCCCTGTTGCAGCTTCCACAGAAGCCCTGTTGCAG

gtgagggccccaccctgtcctgccttcccagcctcacccagctgcatgccagggagctga
gaccaagtctgctgcaatcctccctcacgcaggaggcccagtgctctggcctgagttggg
ttgtggccttaccccaggtgaagcaagagaaggcggatacccaggacgagtggacaccag

 1.14 Intr +   9206   9343  138  1  0   71   81    69 0.741   5.16
cactgaccttgtgtttttacgggaaggcgcaagcagtcctgtgcaggtgccgggccctgt
tgcagcttccacagaagccctgttgcaggtgagggccccaccctgtcctgccttcccagc
ctcacccagctgcatgccagggagctgagaccaagtctgctgcaatcctccctcacgcag
GAGGCCCAGTGCTCTGGCCTGAGTTGGGTTGTGGCCTTACCCCAGGTGAAGCAAGAGAAG
GCGGATACCCAGGACGAGTGGACACCAGGCACAGCTGTCCTGACTTCTCCCGTATTGGTG
CCTGGCTGCCCTAGCAAG
gtgggggcagtgatggatgttctgttggtgccgtagcggagtggtctgtaagcagagtga
tgatgagccatgatggttctcttgagcagagcaatagatgtgctgattgcgacgtttctg
cagaattaccccgcctgtctaacagacaccctacctcccacaggcaactagctttgcccg

 1.15 Intr +   9722   9853  132  1  0   96   49    87 0.653   6.44
agaaaaacggaggtcagtgaggaatgggaatgggaaagctttgtaggcagagagatggac
tttctgtgttgaaatgtgatggaagtaggatttgtcagcacagtgaggggttggctgata
gagactttcctcaggtgaactctgcccttctaatggttgcctgtttcctacttctcccag
GCAGTAGACCCAGGCCTGCCTTCTGTGAAGCAAGAGCCACCTGACCCAGAGGAGGACAAG
GAGGAGAACAAGGATGATTCTGCCTCCAAATTGGCCCCAGAGGAAGAGGCAGGAGGGGCT
GGCACACCCGTG
gtcagtgctggggatgccccaccctgccctgaccctgctgtagccccaacaaccacattg
acctatggtgttaattcttctctagatcacggagattttcagcctgggtggaacccgctt
ccgagatacagcagtctggttgccaaggtgtgccccacacagtgaggggtggggaaggag

 1.16 Intr +   9939  10000   62  2  2   76   75    36 0.338  -1.37
cacctgacccagaggaggacaaggaggagaacaaggatgattctgcctccaaattggccc
cagaggaagaggcaggaggggctggcacacccgtggtcagtgctggggatgccccaccct
gccctgaccctgctgtagccccaacaaccacattgacctatggtgttaattcttctctag
ATCACGGAGATTTTCAGCCTGGGTGGAACCCGCTTCCGAGATACAGCAGTCTGGTTGCCA
AG
gtgtgccccacacagtgaggggtggggaaggagtgggtgttggccagatgtgggccctga
gttttgaaagtatagccggcagtttggcatggtgtggtgggaggtaaaggcccataccca
ctatgctggtcacaattaatgaggggcgtgtgtgtaggaccctagagatttctcctgaga

 1.17 Term +  12993  13089   97  0  1   58   42   120 0.365   1.84
gtctctgtaaggctgttgtctttgcatctaatgctggagcttgaagtctgcagggcaggc
actcgggaagggaagatggatgtaaagtgtgggagaccgaggacacagtggagcccacga
gcacgagctggaacccacgaggatggcctggaacccatgtcagtctctcaccacctccag
CTTCGATGATGTGGGTGTCCTGCAGAAGAAGCTGGTGCCCTTCCTCACAGAGTTAAATAT
GCATCTGGCCCAGGAATTAGAGAAGCTGAAAGGATGA
tcctggggaaggtggagcagctgcaggcctggctgcaggcctgactactgcccacaccaa
cgaggtgatctagcagatacatggcaacgtgtgaactgcaacaacgcctggtgccccagc
accaaccttccaagtgtaaaaacaatgtgctgctgcttcacttccgccctccggttatca

 2.02 PlyA -  13535  13530    6                               1.05
 2.01 Term -  14571  14362  210  0  0  -38   54   243 0.537   5.59

Predicted peptide sequence(s):


>MBD1_1|GENSCAN_predicted_peptide_1|754_aa
XLLLLPVASMAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTR
YLGPACDLTLFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEA
PRDETKADTDTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMF
KVSTTCFLFTTLQWEQDVMELVESEGMMMGPQDEESFYRVLSIDLLRYGDEANGGLKFMV
MPADVGSVDMGGPVLLEQARDLVPTIPGSVWAVGSVQPASCPMMWHRGCSASVNGDAASG
LWKGAEGVEYAGAVRPKRIVAIAPSAFALPALVSGASGNVSSDVAYGTLLTACVAVIRDV
SDALPWLWLPQLVWGVSVSAWCHQAETTLSDLSQGKHARRKGGCDSKMAARRRPGAQPLP
PPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDC
GRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPS
SARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVP
GPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAV
DPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVW
LPSFDDVGVLQKKLVPFLTELNMHLAQELEKLKG

>MBD1_1|GENSCAN_predicted_peptide_2|69_aa
RGGSLIFESNGLRARPSVRAEPPPPHILREGGNENALGPKYGLGKSAQIRGRPLGIPKVV
QPKGPRRNF