GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:20:51

Sequence MALT1_1 : 81152 bp : 39.21% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1459   1667  209  0  2   78   99   322 0.999  28.64
caaacctgtctaattggggcggggagcggagcttcctcctctgagggccgtgccgcgctg
ccagatttgttcttccgcccctgcctccgcggctcggaggcgagcggaaggtgccccggg
gccgaggcccgtgacggggcgggcgggagccccggcagtccggggtcgccggcgagggcc
ATGTCGCTGTTGGGGGACCCGCTACAGGCCCTGCCGCCCTCGGCCGCCCCCACGGGGCCG
CTGCTCGCCCCTCCGGCCGGCGCGACCCTCAACCGCCTGCGGGAGCCGCTGCTGCGGAGG
CTCAGCGAGCTCCTGGATCAGGCGCCCGAGGGCCGGGGCTGGAGGAGACTGGCGGAGCTG
GCGGGGAGTCGCGGGCGCCTCCGCCTCAG
gtgagctcagggccgcggcaggccgggcgcgcgggtcgagcggggtgggctgcggtgggg
aggtgggggcgctgtcggtggggctgagcgcggcgggggccgccggcgtgagtgagcgga
ggtggggaggacttcggtcattgaggcggagcggaactcagcagctccccggaacgcctg

 1.02 Intr +  10985  11151  167  2  2  103   96   123 0.993  13.28
gaggaattccccgtgatgaaagaggaggaaaggatactcgcattcattatgtgaatagtt
tgtcaccacccacccactcacttgtgatttattccatacagcaccaccgtggtccagata
tatagcaggtgtatcatgtggaagaaagctgttgacttgaattctttctgttgctttcag
TTGCCTAGACCTGGAGCAGTGTTCTCTTAAGGTACTGGAGCCTGAAGGAAGCCCCAGCCT
GTGTCTGCTGAAGTTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCT
GCAGGCTATGGAACACACTGAAGTTCTTCAGCTTCTCAGCCCCCCAG
gtaggttttgttcttaggattattctccaggagttcatggagccaaacttagaagaaatt
atctcttttgaccaggtgaactgtgttaagtatttttggaaaatgtaaatgtgtagtgcc
ttgtttgctttcccaggttgaagcaaatgcaatgcatgaatattggttggattgtggttg

 1.03 Intr +  20151  20347  197  1  2   22   28   210 0.839   6.61
tatctctgtgtcacaccttggtaactcttacaatatttcgaactttttcattatatctgt
cgtggtgatctgtgatcggtgatctttggtgttactactgtgattgttggtgcctggtaa
gatggtggcatccaggtggcggtcttaagaccagatcagtatggtgttggtggtcttaag
ACCAGATCAGTATGGTGTTGGCAGATCAGTATGGTGCCGCTAGGCAGGCACTGACTAGCT
CCAGGCAGCTCAACCTTGGGAGCTTCGGGGCCCCGAGAGGTGGAGCCTGTGAGTGGGGCA
TGCACTCCATGTGGAAGCCAGAGCCTCCTCCCCTGGATGGAGTGTACGAGATCCCTGGAC
CGGAGCCCATCCCCTCT
gtgagagagatgtacttcacgcccgggctgccaccgctgatcttcctgccctgggaccct
gggtagaaacacccaaaattctgttcaccccgttcacgaccctgggaccctggctcgaag
cacccaaagttctgctgctcaagctccattcacgagcagccaccatacaaagaccaggcc

 1.04 Intr +  21012  21261  250  2  1   82   -6   269 0.010  12.99
aaaactccacgttatccaccacctggaattgtgtctgttcttcagggtcatggttctagt
ggagccggctgagtgccaaggatcctctgcccccgccatctcctccagagaagaggttga
agctactaaaaatcatgttctcgaggccttctgtcccctctccccactactgatcttcag
GAATGCAATGTTTCTGATGTGAAAGATGACACAGGATTCTGGGAGGGCTATCCTTACCCC
TATCTCCATATCCTGCACTTCCTGGAGAAAGCCGATTTGCAACCACATAGCCTTCAACCA
GATCAGCTGTGGGCCAAGATGATCCTGTTTGCTTTTGGCATTGCCCTGGCTCAGGCCCAG
CTCCTCTGTGGCAATGACACCAAGATCTCGGAGCAGCCCGTGGTTGTGCAGAGTACATGC
ACAGACGGAC
gtgcattccatttcctggtgttacagtagaacaccacagacctggcctcttaacaagtgt
ggcaagagtttggtctgggtggaatcatgccagctactctctcagcatttttggtgtctc
ccagtgataaaaaagaaggtgggaccgggcccagtggctcgcacctgtaatcccaacact

 1.05 Intr +  26181  26302  122  1  2  134   76    16 0.994   4.29
tacaaaagctgcaactcacaaagtgtaaattgattgagaaggagatgtgaatgagtgatt
tatgacaaagataaatatgcaagttatttctaaaatgtttcaatttttggtttcagatgt
ataaacaaggaaaatccctcttgtgactttaattttttttttttttttttttttttttag
GAATAAAGATTACTGTAAACCCAGAGTCAAAGGCAGTCTTGGCTGGACAGTTTGTGAAAC
TGTGTTGCCGGGCAACTGGACATCCTTTTGTTCAATATCAGTGGTTCAAAATGAATAAAG
AG
gtaattttttaaatatatcttttaattcttccaaggagagagaatgatagagaattaatt
aacattatcgtcctaaatgtagttttaacagtttggtaaaagagtctgatagacattgct
aggttattactgaagtagtcaatagtcattattttggtaagacagttccagaattgtctc

 1.06 Intr +  29720  29803   84  1  0   91   62    45 0.485   1.30
tgtaatgaggcacttgagtaagccccttggcaatgtgccaaagttgggtgtagctgatca
attgctgggagcagaaaaagcattaataaaagaaaccttactattggaggtggggactgt
ggatggccatcccgtcttactgtctcattgatatgctttccatagctcttctctgtctag
ACCTTGAAGGAGATTGGATATTGTTTGGTTAAGGAGTTTATCCTCTTACAGAATTTTGCA
GATCAGAAGGTCCGGGGTCTCAAG
gtgaaataacttgcccacgtcttcccagctaatgtggtcagagctgaaagcaatagccaa
gcccaattctctgtgttttctctatgccgctgtggtgtttgtatgttgtatggctgctaa
actcataaatgttgcagttgtagattctttcaatactcagtgattgatctcttaaatgcc

 1.07 Intr +  30256  30406  151  0  1   91   89   106 0.808   9.81
taatacttcagtcctaaataactcaaagcgttactgtttttaactcagaaatgttttaga
acttgggggaaaaatgttgcactttcaaagcttcatactgaaatcatagattttgtacag
catattttataaggtgtgtttttgatgagtcatccacttctcttattgattctttcacag
ATTCCAAATGGAAATACATCAGAGCTTATTTTTAATGCAGTGCATGTAAAAGATGCAGGC
TTTTATGTCTGTCGAGTTAATAACAATTTCACCTTTGAATTCAGCCAGTGGTCACAGCTG
GATGTTTGCGACATCCCAGAGAGCTTCCAGA
gtaagtaacgaaagaagctgaatgttgggatggggattccccatattttattttatttta
aatgtttacttttaaacaatttcaaagtatcaaaaaacatagcaaaatttcacataggta
cttcatccattataatgtcaaccattgttaagatttgatccatgtgttttgtctttcttt

 1.08 Intr +  43898  43924   27  0  0   96  105    13 0.048   0.97
aatattcactattctttgctattcagtatttgcatggcttcttcatttaatttgaaaagt
tgtaaactgataaaacactataacatgattcactggctcaaaactacttggattagtctt
actatttgtgctaaattggtgtttagattacttaatctattttctcttactttgttttag
ATGAATTAAATAATCTTGGTCATCCTG
gtgagtaatacaaacataaaactttagttttagatttttaagttgttgaatgcagcaaag
ttaccgtaggtactcttttgctacagtaatactagtaacttttttctctttattgaaata
atataatttaaggttgaaattaactacatgaagtacaattttatacaagtgatacattaa

 1.09 Intr +  52863  53066  204  1  0   85   95   206 0.265  19.25
tcctcagagaatattgatctgcttacataaatagttctaaaatgaaattaaataatgaaa
tcttatttgaaatgaaataatgcaatcttaaagcatactttttattataataccatctcc
ataggttttgttttaatctttatatcttctttaaacaccccctttctttttttttcaaag
CGAAGGACAAGGTTGCCCTTTTGATAGGAAATATGAATTACCGGGAGCACCCCAAGCTCA
AAGCTCCTTTGGTGGATGTGTACGAATTGACTAACTTACTGAGACAGCTGGACTTCAAAG
TGGTTTCACTGTTGGATCTTACTGAATATGAGATGCGTAATGCTGTGGATGAGTTTTTAC
TCCTTTTAGACAAGGGAGTATATG
gtaagatatttataatgtttgtttttacaattatccattattcttttcattatacaagtt
aggttaagaattgaaaatcagataaagataaggtaaacatgttgttgaatggaagagttt
tatttttcttattaagatgatacatttgatcttcattccatctgaataactaattagctt

 1.10 Intr +  63212  63389  178  0  1  124  115    86 0.981  12.96
caataattttaaatgcaaaataacattgtctatatttataattgggtatttcttacatat
gctcacatcaacctgaagaaaattaaagtcaaggtttttctacaaaaagttatgcagtct
gtatgttcagagtgcatttagaattgacatctatctctctcttatttttcctcttttcag
GGTTATTATATTATGCAGGACATGGTTATGAAAATTTTGGGAACAGCTTCATGGTCCCCG
TTGATGCTCCAAATCCATATAGGTCTGAAAATTGTCTGTGTGTACAAAATATACTGAAAT
TGATGCAAGAAAAAGAAACTGGACTTAATGTGTTCTTATTGGATATGTGTAGGAAAAG
gtaagttttctaatctttattaaagaattgttggagttaaatatcgaccatgacaaacta
gagaaacctgtgaaatgctaaaagccatttgcgtttgtgaattttagtttatacattgaa
actggaagaacaaaactagaggaaaatacatttactccatgtatatctaattattttaac

 1.11 Intr +  64122  64196   75  0  0   69   76   121 0.991   6.71
caaggagttagtgggttattttgggtagatatgtagctacctagatgaaaaattttgaat
ctataattttaaattatgtattctaaaaaactgttgtattttctcattatttataccctt
ttaagaatgctctttaacttttcatatttctatctgccctcctccgcctcccttaaatag
AAATGACTACGATGATACCATTCCAATCTTGGATGCACTAAAAGTCACCGCCAATATTGT
GTTTGGATATGCCAC
gtaagaacatttgatgtttacgttgaagtttcctttattgtttgatgtctttttgttttt
gctttttaggagcaggggtcttaactctgtcacccaggctggagtgcagaggcgccatca
tagctcactgctcctgggctcaagcgatcctcctgcctcagccttctgagtcgctgggat

 1.12 Intr +  65017  65144  128  1  2  111   93   120 0.996  14.20
tgaaacattgtaccctgtgactaacagtccccacgctgtccccacccccccccagcctct
ggtaaccaccattctgctgggtgcttctctgagttcatttttattagcatccacatataa
gtgagaacatacagtatttgcctttctgtgcctggcttaacttctttttctatttttaag
GTGTCAAGGAGCAGAAGCTTTTGAAATCCAGCATTCTGGATTGGCAAATGGAATCTTTAT
GAAATTTTTAAAAGACAGATTATTAGAAGATAAGAAAATCACTGTGTTACTGGATGAAGT
TGCAGAAG
gtaaaataaaaaataaagagaaaagtactcagaaaaaggagagcaggggagacacaccta
ttcagggttccctctctggtgattgttttattcttattatgtgggtttggaattagtacc
tactttataaaacaatttttatattaatataacgttcagcaacacttctgctatttaatg

 1.13 Intr +  71680  71829  150  2  0   90   64   140 0.921  11.01
gagtaaaaattaaaacatgcctgatatgtctggcacataataggtgctcaggaaatattt
gttgagtgaataaatgatactgagaatataacctgataatgtaggatagttcttagccta
aatatttaaaacataagaattggtggtcttaaaaataatatttattttcatatcttttag
ATATGGGTAAGTGTCACCTTACCAAAGGCAAACAGGCTCTAGAGATTCGAAGTAGTTTAT
CTGAGAAGAGAGCACTTACTGATCCAATACAGGGAACAGAATATTCTGCTGAATCTCTTG
TGCGGAATCTACAGTGGGCCAAGGCTCATG
gtacggtaaagcccattttttgttagatctacaatatacttaacgttaaatcataaagtt
tcttctgaataaataactttcctcccagttttacagtgaaaatattttggcctactaggc
aaatctcaaaccaaacaaatatttcaattatggatattacactggcttatttgatttaga

 1.14 Intr +  74153  74310  158  0  2   94   70    54 0.948   3.01
gtaaatgaaagactttgtttggccagcagaatagtgagcattattttttaaattgtatgt
gtttaaacaatgtaaatcatgtttttaagcaaaagaaatgctaactatattctcctccat
aaatatttgcctcttatcatcagaaaacctaccaaagttgttcttattgttctttttcag
AACTTCCAGAAAGTATGTGTCTTAAGTTTGACTGTGGTGTTCAGATTCAATTAGGATTTG
CAGCTGAGTTTTCCAATGTCATGATCATCTATACAAGTATAGTTTACAAACCACCGGAGA
TAATAATGTGTGATGCCTACGTTACTGATTTTCCACTT
gtgagtctcttcttttatttaaaatacagtgatatattctcacttattaaagactaaatt
ttttaaaacttaaagttgatggtaaatataaaggaaatatatatatttatatatgtgtat
atatttatagtttagtaacactgatcataatatttactaattgccaaaataccttaagtt

 1.15 Intr +  75481  75606  126  0  0  116   27    68 0.523   3.46
tattataaccatagattgttgttttcattgtttagtcctggataattttgggattaccaa
aattcacgagaggccagaattcacgagaggatagtatcagttaagatgtcttatgtacta
gattatattgtggctttcattgatttcattattaacagtccctaatttttttttttacag
GATCTAGATATTGATCCAAAAGATGCAAATAAAGGCACACCTGAAGAAACTGGCAGCTAC
TTGGTATCAAAGGATCTTCCCAAGCATTGCCTCTATACCAGACTCAGTTCACTGCAAAAA
TTAAAG
gttactaccttttctgtttatagctactaatggaaaactttatgaaactggaaacttatt
ttggcatagaccatagatatgctgccttattattaaagtagagataaccagtctacagaa
ggtcctatcagtgaccctttttatattctgtttccgatggtgaccagaggactttatgtg

 1.16 Intr +  77220  77478  259  2  1  125   49    67 0.122   2.61
ataatgatagctggcgtttctcagtttcagggagatataaaggatgccttgaggatttgg
aacctgggaaaggagagtgagtggatttttgggggtgggggtgtgtatgtgtgaatattt
tcagattgatatatattcactgttgatgccaataataaaccagatttttttccttttcag
GAACATCTAGTCTTCACAGTATGTTTATCATATCAGTACTCAGGATTGGAAGATACTGTA
GAGGACAAGCAGGAAGTGAATGTTGGGAAACCTCTCATTGCTAAATTAGACATGCATCGA
GGTTTGGGAAGGAAGACTTGCTTTCAAACTTGTCTTATGTCTAATGGTCCTTACCAGAGT
TCTGCAGCCACCTCAGGAGGAGCAGGGCATTATCACTCATTGCAAGACCCATTCCATGGT
GTTTACCATTCACATCCTG
gtaatccaagtaatgttacaccagcagatagctgtcattgcagccggactccagatgcat
ttatttcaagtttcgctcaccatgcttcatgtcattttagtagaagtaatgtgccagtag
agacaactgatgaaataccatttagtttctctgacaggctcagaatttctgaaaaatgac

 1.17 Intr +  79550  79801  252  0  0   43   76   101 0.082   0.88
tcaaatttttcacccatttacacatatccacaaatgactgcaaaagtgccacggatatca
atttgagggttataaattttagcaagttggtaaattcacaaatacataaccttgaataat
gaggatcaactgtaccatatttaataaagcacaaaacccacacagattgtcttattacag
CATTTGATAAAATCCAAAACTCTTTCATAAAAACACTCAACAAACTTAGGAATAAAAGGA
ATCTTCCTAGATATGATAAATATAACATCTATGAAAAGCCCACACCTAACATTATACTTC
ATGGTGATAGACTGAAGGCTGAATGTTTTCCCCTTAAGATTGGGAAGAAGGACAAGGATG
TTCACTCGGCACTACTTCTATTCAGCATTGTACTTGAAGTTCTAGCCACAGCAGTTAGGT
TAGGAATTCAAG
gtttgttcaacatctaaaaatcaaataagctaataaagaaaagaggtttatactgcaaaa
gaagtgaaactatatgtattcacagttgatacatagttgtatatagaaaatgctaaagaa
tccataaaaagtaataaatgagttcaacaggttgcaggatacaagatcagttttatttct

 1.18 Term +  80204  80325  122  0  2   67   47    63 0.112  -2.24
tatatacagtagcatcaagaataaaactccaacacgtttaaagaaattaagatccagata
aatggaaagacatccatgttcatggattggaagactgaatattggtaagatggcaatgct
gcccaaattagtctacatattcaacaattcctatcaaaatcctagctgtattttttgcag
AAATTGACAAACTGGTAAAATTGGTAGGGAAACGCAGGGGACCCAGAATAGCCAAAAAAC
CTTGGAAAAGAACAAAGTTGGAAGACGTACCAATTTCAAAAAGTGCTACCAAGCTACAAT
AA
gacagtgtaggcatatggatagacatatcgatcagaggaatggaactgaacatccagaaa
taaacccatacatttctggtcaacttgttttcaacaaggatgccaataccatcaatagag
aaggagtggtcttttcaacaaacggtgctgggacaactaactggtagctacgtgcacagc

Predicted peptide sequence(s):


>MALT1_1|GENSCAN_predicted_peptide_1|952_aa
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPDQISMVLADQYGAARQALTSSRQLNLGSFGAPRGGACEWGMHSMWKPEPPPLDGV
YEIPGPEPIPSECNVSDVKDDTGFWEGYPYPYLHILHFLEKADLQPHSLQPDQLWAKMIL
FAFGIALAQAQLLCGNDTKISEQPVVVQSTCTDGRIKITVNPESKAVLAGQFVKLCCRAT
GHPFVQYQWFKMNKETLKEIGYCLVKEFILLQNFADQKVRGLKIPNGNTSELIFNAVHVK
DAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQNELNNLGHPAKDKVALLIGNMNYREHP
KLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGY
ENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPIL
DALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMG
KCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCG
VQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSY
LVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDM
HRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPAFDKIQNSFIKT
LNKLRNKRNLPRYDKYNIYEKPTPNIILHGDRLKAECFPLKIGKKDKDVHSALLLFSIVL
EVLATAVRLGIQEIDKLVKLVGKRRGPRIAKKPWKRTKLEDVPISKSATKLQ