GENSCAN 1.0	Date run: 15-Jan-104	Time: 16:32:59

Sequence ADCYAP1_1 : 8067 bp : 52.54% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    688    875  188  0  2   17   86   169 0.862   8.61
ctgactttccctctttcccttaatcgcctgcttcttcctccgggtggacttacggccacc
ttgctcctccgcgcttcacctcatcgccccctctttctttcttctgcctctctctctgcg
cccccttctctccgtgtcacgctccctcctggttctgcgcgtctacaaacttttgagcag
AACACGAGCCTCGGCAAACGAGTCCCGCAGCTCCTCCTGCTGCTCCCGCTGGTTCCTGCG
GCTTCTGCTCAGACACCAACGCCAGACGGCGATGCCTCTCGGGTGGTGACTCCAGCGCAG
GAACTTGAAGAAGCGCTTTGCCCGCCGTCCTACCTGGCAGCTCTCCTGGCAGCGGGAGGA
GTTGAAGG
gtaagggagggaaaatcttaccaaagcgaccggctcactcgactgctgattctttcgctt
ggcatcgcgtcaggggagttagctttccttcagccgggtctggctagttattgggcgccg
ggtagatgcatatatatatatttttttctaactatagcaagcaagaagtggcagggcgcg

 1.02 Intr +   1201   1311  111  1  0   88   96    92 0.986  10.00
ttctaactatagcaagcaagaagtggcagggcgcgcaccggctgtcgccaagtgctgttc
aactcagggagccggggcttcgctccgtccctcccccggcttccagagctttttggggtt
ggagggtgggaggccaggggcgttctcacagctgtgtgtcctctttcccatcctgcgcag
AATGACCATGTGTAGCGGAGCGAGGCTGGCCCTGCTGGTCTATGGGATAATCATGCACAG
CAGCGTCTACAGCTCACCTGCCGCCGCCGGACTCCGGTTCCCCGGGATCAG
gtaggtgctggctgcctggcccaagcaggagctggggcttcccaggcacagacgcttcct
cacggtctccttcctgcagtcctttgggtccagactactagcatcgccctctgcgccccc
ggtgcgcctccgccagcctcggctggacagcgggtccccattctagccgagggtctggca

 1.03 Intr +   3474   3605  132  0  0  101  100   137 0.964  16.47
ttgggtgtcgttgcctcctccttacctctgctcccacccccagtcctgggagaagagaca
attctcagcggaggacttttatcacctgtgaaaatccgcgcgagccccttactttggatc
ctcgccgagctggggaggaacttgcactgaccacaccttctgtccccggccaccccgcag
GCCAGAGGAAGAGGCGTACGGCGAGGACGGAAACCCGCTGCCAGACTTCGATGGCTCGGA
GCCGCCGGGCGCAGGGAGCCCCGCCTCCGCGCCGCGCGCCGCCGCCGCCTGGTACCGCCC
GGCCGGGAGAAG
gtgagattcgcgcggcctcgcgcacacccgcggctgggagctcgggactgcggtgacggg
aggggcagtgtggtgacccacccaggatttttttttttttcccgtgaaagtcctcaagcc
tgtcctctccctggcccgatcctattgcagcgacagaaaatcagcagcgggcgggtctgt

 1.04 Intr +   4080   4178   99  0  0   50   78   181 0.998  13.02
ccgatcctagcagttgctctcgagatcatcccgggagttattggcgagttctgggcctct
ggaggtttccctgtcagcctccccggccgccgagggggcgcgcgcccaacaagggggtct
ctagcggccacctggggacagaaacagtgaccctgggcgcgcactttgcctccccgttag
AGATGTCGCCCACGGGATCCTTAACGAGGCCTACCGCAAAGTGCTGGACCAGCTGTCCGC
CGGGAAGCACCTGCAGTCGCTCGTGGCCCGGGGCGTGGG
gtaagagtttgtggaaggattaacctgcgcgcgccggggtgggtgcctgtgcggggcgcg
cggggcgggcggcggtgggtgcccgtgggggccagggtgagtctgcgcccctgggtctgg
ggtgggcatccgccacgggtcgcagttggagattttgaagtggcactttaaatttgccca

 1.05 Intr +   5261   5401  141  2  0  107   60   325 0.486  31.58
ggctgccgtctcggccctccccacggctgcttccaggcagaggcgggcgacgcggtgggc
agtgcgagccccgggccctccccgaaggctcccgcgtggggtggggcccgcctgctcccc
gcggcgattgaacctgtgtctcccgccccgccaccctcttcccgacccctttgcttgcag
TGGGAGCCTCGGCGGCGGCGCGGGGGACGACGCGGAGCCGCTCTCCAAGCGCCACTCGGA
CGGGATCTTCACGGACAGCTACAGCCGCTACCGGAAACAAATGGCTGTCAAGAAATACTT
GGCGGCCGTCCTAGGGAAGAG
gtataaacaaagggttaaaaacaaaggacgccgaatagcttatttgtagcgatgggttac
cagctaccctgtgtatacagccctgacgcaatgaaaagtcgttttccaaactgactcaac
agtcatcgctcgtgtgttctatccaaacatgtatttatgtaatgaagtaaagccattaaa

 1.06 Term +   7775   7829   55  2  1   83   43    51 0.036  -2.58
ttagtcttaattatttgtttcttggataatgggcagagttttctgtatttgtatcagctg
ttagtggtgaaatagggctctagttaaccttttatttatgaagtctaatttagtgttccc
gtggctagttgcaagcattttacagtgatcacccagtttaatcttttgtatactttttag
AAATGCCAAGAGCCTTACTAAACTGAAGCAGATTTATGATATAGTGATAATTTAG
gtagatgttagtcttgaagctcttattttgtgtgcaactgattataaaaacaccttaacc
aagtattattacacacatgatatctataactaggactttgataactgttatataaagtgt
gtaaaatttgtatgaataaatttttgtaaacaatgcaacttggtctaatgtttgggaaaa

Predicted peptide sequence(s):


>ADCYAP1_1|GENSCAN_predicted_peptide_1|241_aa
NTSLGKRVPQLLLLLPLVPAASAQTPTPDGDASRVVTPAQELEEALCPPSYLAALLAAGG
VEGMTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSE
PPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSL
GGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRNAKSLTKLKQIYDIVI
I