GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:12:45

Sequence ACAA2_1 : 32427 bp : 40.07% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1249   1264   16  0  1  118   83    54 0.012   6.45
acgcgtggggtaggaccatcttacgctgggaccccgccaaggagccccaggaagtaggtg
aaagggcaggggcgtggctctcggggcgccacccacgctcttgaaatctgggtgattgcg
agcggccgctcagcgtcccccacaccacagacccgcgccgccgacgacccagcagccgcc
ATGGCTCTGCTCCGAG
gtgagcgcagccccctcctcctctcctcgcccctcggggtcctgccctccccaggccagg
cctccgcttccggccgccgcggagagtcggggtcgtggggtgaagttcactcaacctcct
cggttttggagcggacgtgataaaaacccagcccgaaaggcttgtttgggttaaggagaa

 1.02 Intr +  11880  12046  167  1  2   78   92   220 0.568  20.16
aaactggtagtccttaagactctgcttccatgggtatgacttgttctaggtattattgcc
taacagaaatttccattatctaattttaaattgtgtaaggtttcacagtgagattattcg
aagcatttagaggtatttactaacctgtgatggcttacaaatctcttcttgttgcaatag
GTGTGTTTGTAGTTGCTGCTAAGCGAACGCCCTTTGGAGCTTACGGAGGCCTTCTGAAAG
ACTTCACTGCTACTGACTTGTCTGAATTTGCTGCCAAGGCTGCCTTGTCTGCTGGCAAAG
TCTCACCTGAAACAGTTGACAGTGTGATTATGGGCAATGTCCTGCAG
gttagtagagtaaaggaaggtgttcactcctattgcttctttgatcagtttctaaaaata
attcctttaacatatcataatggtaaacaagttaataatagttatagacttttttttttt
ttttttgagatggagtctcgctctgccgccaggctggagtatggtggtgcgatcttggct

 1.03 Intr +  17139  17267  129  2  0   97   80    43 0.952   4.37
tattcaaattgtaaacacatattagatataatatgctgtacttagatgcattttgtccta
ccttagagccatatagtttatcatttttgatagattgccaacatttccatgtatttcgtg
cttgttcttaattagtagatttatagagaaaattatttttcttttccttctctcttctag
AGTTCTTCAGATGCTATATATTTGGCAAGGCATGTTGGTTTGCGTGTGGGAATCCCAAAG
GAGACCCCAGCTCTCACGATTAATAGGCTCTGTGGTTCTGGTTTTCAGTCCATTGTGAAT
GGATGTCAG
gtatggacaacatttttttaaattctctgaaaatatgttaatagttactagaagaaatgt
cccactgcaatataacactttagctttagggaggattgcttgagccctggaggtcaagta
aaccatgatcataccactgcactccagccatgggcaacagagtgagaccttggctccaaa

 1.04 Intr +  18852  18968  117  2  0   64   53   127 0.967   6.54
tggtaatggatactttagcatttgctttacagttactttaaaagcatttccttttgagac
actgtaagctacagtacaatatttgtttgatttaccattaatttgtaaaatcagtgtgtt
tcttaatacattgtttgggtacggtaaaaggagtttttattactgtttgtttttaaatag
GAAATTTGTGTTAAAGAAGCTGAAGTTGTTTTATGTGGAGGAACCGAAAGCATGAGCCAA
GCTCCCTACTGTGTCAGAAATGTGCGTTTTGGAACCAAGCTTGGATCAGATATCAAG
gttggaaccataaaaatttaaaagaattagttcttattagcattatataagtacttttaa
taacatacctttttatgggagagaaaactaattttgaagccaatttcgttgatgaggatt
ggcaagatatgaatgattagaagtttgtaaactatttcaaaactctattttggtggttag

 1.05 Intr +  20306  20453  148  1  1   65  105   104 0.980   8.69
gttttcaaaaacattgcatgtttttaaaaaatatcccataactgaatatgaatagtggtt
atcagaaagtcttaattttacttttgtttattggaagtgttgattatttaaagaaattat
aacatattacttttaaaaggaaatgccttaacaagtcactttattaatgtcttttaatag
CTGGAAGATTCTTTATGGGTATCATTAACAGATCAGCATGTCCAGCTCCCCATGGCAATG
ACTGCAGAGAATCTTGCTGTAAAACACAAAATAAGCAGAGAAGAATGTGACAAATATGCC
CTGCAGTCACAGCAGAGATGGAAAGCTG
gtgagtgaaactggaaagtatcagtatctatagaataaatatctataggaaatattttca
tcatttctattatggttatataatatttacaaatcatacctttaagaattattacatctt
ttcattattcctttgtctttagatgatcagatattttattaattattgcaaaattaacta

 1.06 Intr +  22406  22581  176  0  2   97   20   232 0.979  16.04
gtgccgttgcactccagcccaggcgacaatgtgagactccatctcaaaaattaataaaga
ctcaatattaaagtagactgtgaggaaaaggtagatcagaaattaaattgaataatatgt
ttgatttattttcatgtttctctcttttattcttatgatagtctctctactatttttcag
CTAATGATGCTGGCTACTTTAATGATGAAATGGCACCAATTGAAGTGAAGACAAAGAAAG
GAAAACAGACAATGCAGGTAGACGAGCATGCTCGGCCCCAAACCACCCTGGAACAGTTAC
AGAAACTTCCTCCAGTATTCAAGAAAGATGGAACTGTTACTGCAGGGAATGCATCG
gttggtatcaccacacagattagcttgaattcttcctggtgtgttcaacaaaagtaatca
tgaagtatcttgtaaatactttttatgccagtctttagttgtttagcttaaactaatagt
gttcatattcaattaatttaggttttcatagacccacacaaaatcttttcatatttattt

 1.07 Intr +  23134  23263  130  0  1   55  111   148 0.982  13.15
tattctgtgccttaaaaaatctccttcatccaccacagtaccacttttctaattgtatct
cacactgtgcactggcttcctatgtactgccatattcctaatactactagtccattagtt
caaactttgattaactggattattttagcctttagttaatctagtatttttattttcaag
GGTGTAGCTGATGGTGCTGGAGCTGTTATCATAGCTAGTGAAGATGCTGTTAAGAAACAT
AACTTCACACCACTGGCAAGAATTGTGGGCTACTTTGTATCTGGATGTGATCCCTCTATC
ATGGGTATTG
gtaagtttatagtaaaacaaactggttctataatatttctggaggtaagtcttctttggc
attcagagtcctgaaaaagtggccaaaccaaggtcacctgtagagaaaagaagattggta
atcagtttaaataaaaaatctttatgaagaactgtcctagacacaatagaaaaaccaaga

 1.08 Intr +  27351  27442   92  1  2   70  107    29 0.594   1.79
atgagccaccatgcctgggccctttttctgcctctttatggtcacttcatttaataggta
cggtcaaggtagtaagatttgtggctactaataactgccgcattatttcttccttacttg
gaaagaaggagaagcttgatacgtaaatataagatgacatttatttctatatttttatag
AAGATTTTTATTATTATATAGGTCCTGTCCCTGCTATCAGTGGGGCACTGAAGAAAGCAG
GACTGAGTCTTAAGGACATGGATTTGGTAGAG
gtaagtgtttttttttttttttttttttttaacaacatgaataaaccatgtacttttata
gcataaatgactttaatttggtctcattgctctttgaatttcattgtagttagcctttcc
aaatgatgtacatctaaataaatagtaccttcattagatgccttgtgttgatacttttcc

 1.09 Intr +  29382  29536  155  2  2   72   63   160 0.976   9.85
aaatatacacattttaaacctgatagctttatgcagaatgattgtagataaaataacttt
gcgaggtaatttaaataggaagaaacagcagacttagctgttgataggactggaccattc
tcatttaaaaattagtttgtgagtaaggatttttgttagtgctctaatttttgttttaag
GTGAATGAAGCTTTTGCTCCCCAGTACTTGGCTGTTGAGAGGAGTTTGGATCTTGACATA
AGTAAAACCAATGTGAATGGAGGAGCCATTGCTTTGGGTCACCCACTGGGAGGATCTGGA
TCAAGAATTACTGCACACCTGGTTCACGAATTAAG
gtatttgctagaaatagctgcatttcagatttgctgttttttatagaaatgcatggattt
aggcttccccagaacactccaacatttttcattcttcttcatgtctcctgcactggctgt
taccaggaacaagttacttgggcagtgcttttcatctggtctcatagatgagtcagtcac

 1.10 Intr +  30802  30854   53  1  2   70   67    66 0.565   0.33
aaaactttcagctttccaaagtctgttgcctgttgtaattataccaaaattgaggactgg
ggaaaagattgagcagatgagctgaataaggatgagtaatgcagatgtgatgttattagt
tctatttcattaatctgattttttattagagtagatttcagtcactgctttctttttcag
GCGTCGAGGTGGAAAATATGCCGTTGGATCAGCTTGCATTGGAGGTGGCCAAG
gtattgctgtcatcattcagagcacagcctgaagagaccagtgagctcactgtgacccat
ccttactctacttggccaggccacagtaaaacaagtgaccttcagagcagctgccacaac
tggccatgccctgccattgaaacagtgattaagtttgatcaagccatggtgacacaaaaa

 1.11 Term +  30934  31052  119  2  2   80   49    84 0.598   1.42
atctgattttttattagagtagatttcagtcactgctttctttttcaggcgtcgaggtgg
aaaatatgccgttggatcagcttgcattggaggtggccaaggtattgctgtcatcattca
gagcacagcctgaagagaccagtgagctcactgtgacccatccttactctacttggccag
GCCACAGTAAAACAAGTGACCTTCAGAGCAGCTGCCACAACTGGCCATGCCCTGCCATTG
AAACAGTGATTAAGTTTGATCAAGCCATGGTGACACAAAAATGCATTGATCATGAATAG
gagcccatgctagaagtacattctctcagatttgaaccagtgaaatatgatgtatttctg
agctaaaactcaactatagaagacattaaaagaaatcgtattcttgccaagtaaccacca
cttctgccttagataatatgattataaggaaatcaaataaatgttgccttaacttcagtt

Predicted peptide sequence(s):


>ACAA2_1|GENSCAN_predicted_peptide_1|433_aa
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIEDFYYY
IGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHP
LGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGHSKTSDLQSSCHNWPCPAIETVIKF
DQAMVTQKCIDHE