GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:38:57

Sequence YWHAE_1 : 58038 bp : 44.95% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1280   1343   64  1  1   85  113   138 0.132  17.31
cgcgccagttgccagggagcggttgccatagagctgagcagttgtccgcgtgcgcaggcg
gaagtcccggattgaggcgccgccatttttgctgcccggacgcggagcgagaggctgaga
gagtcggagacactatccgcttccatccgtcgcgcagaccctgccggagccgctgccgct
ATGGATGATCGAGAGGATCTGGTGTACCAGGCGAAGCTGGCCGAGCAGGCTGAGCGATAC
GACG
gtgagttgggggggcaacggggggctggaattctcggaccctctgccgccgcccacagag
gccgggaacaggagacaaaatggcggcatcgtctgcgagcctggcccgggggcttgggtt
cgggaagcaggaaatggcctgggagctcccggggcgatgggaggctctatgccctggaat

 1.02 Intr +  36332  36531  200  0  2   91   81   182 0.425  16.87
cttagtttggtttcctttacatgtttttggctttttactcatattagttttgatgattat
gaaattatttttgttaaaatgtttttttcgcagtagcttgacagaaaaaaactactttga
aaggaatatgttaagaaaacttcaaatttgtaaggtctgacttttccttttcccatacag
AAATGGTGGAGTCAATGAAGAAAGTAGCAGGGATGGATGTGGAGCTGACAGTTGAAGAAA
GAAACCTCCTATCTGTTGCATATAAGAATGTGATTGGAGCTAGAAGAGCCTCCTGGAGAA
TAATCAGCAGCATTGAACAGAAAGAAGAAAACAAGGGAGGAGAAGACAAGCTAAAAATGA
TTCGGGAATATCGGCAAATG
gtgagattgttgtgccatcatccccccttatccacagtttgagttacctgtaggacggta
cacttaagattttgagagaaaaggagactacattcatataacttgtattacagtatgtta
taatgtttctgatattgatctttgtgcctggtttataagttaaacttacccgtggctatg

 1.03 Intr +  39382  39488  107  0  2   97   51    30 0.991  -0.79
tttataacctagaggcagcttttctctgcttttgtgtcaagaaggaagaagggagtttgg
agagggatacaaattctttttaatactaagctctctacctcaaaaccagagatagaatat
gtaataatttgtagaatttctagacttaatctgatttaaaaaaaatttttttttttttag
GTTGAGACTGAGCTAAAGTTAATCTGTTGTGACATTCTGGATGTACTGGACAAACACCTC
ATTCCAGCAGCTAACACTGGCGAGTCCAAGGTTTTCTATTATAAAAT
gtaggttctatactagaagggaaaatgtaagattgaaagttggtccttttagaaccataa
ctttgttctatgtaggttttcaacttttatttaagaataattgttcaatgttagaaggat
agttaatattgtaatgaaaaggtggttgggctattatgaaaatgtattagcttttgctta

 1.04 Intr +  40092  40298  207  0  0   75  111   147 0.997  13.89
gaaaaaaatgaaacgaagccagttattcctgagagtgtttaaaattattgaagtacacct
aattgttacatatatttttgtcacattttatataatatagaacaattttagcttattttc
ctttaaaaatcgttcctagtttaaattttttttttttttttaattttggttttgttttag
GAAAGGGGACTACCACAGGTATCTGGCAGAATTTGCCACAGGAAACGACAGGAAGGAGGC
TGCGGAGAACAGCCTAGTGGCTTATAAAGCTGCTAGTGATATTGCAATGACAGAACTTCC
ACCAACGCATCCTATTCGCTTAGGTCTTGCTCTCAATTTTTCCGTATTCTACTACGAAAT
TCTTAATTCCCCTGACCGTGCCTGCAG
gtaagttgtggggaagaacagcagcgctcagcgtgaaagttaaggggggcgctgtttggg
ttttccgtgttgtttcttgggcctgtctttgtagacttggctgcatagtaattcttttgg
ctcttactgaaactactttggatagtattaaaacagacctgtctcaacccactagcatag

 1.05 Intr +  47043  47179  137  0  2   57  115   143 0.998  14.11
gtaagaagtagtgttccacatacctttaagttaatttttattgtatttgctttttctttg
cattatcattgtgactattacaaactggaataactgaagaaaagattgctgtctagcatg
tcatttctaattctgattttggacttaatttttataacacttctattgaaatacctttag
GTTGGCAAAAGCAGCTTTTGATGATGCAATTGCAGAACTGGATACGCTGAGTGAAGAAAG
CTATAAGGACTCTACACTTATCATGCAGTTGTTACGTGATAATCTGACACTATGGACTTC
AGACATGCAGGGTGACG
gtaagcaagcacggagtgaaacaggcacctctttcagttgcaggatttgtttgtactctc
tttagacattccttggcttgtcgttatatcaagctagaatttagattcaccgcctgccct
ctatgaaattgtaattgctgcctttataggaaatggtgctacagtacggagttccatttt

 1.06 Term +  55891  55943   53  2  2  118   53    98 0.618   6.89
ataatcccttcttggcttaggcatctcaggtgtcaaggatgatagaagtcctttgcctgc
gtttaataccaattgtagcaagtagaagagtctttatgcttggaatgacacctttgtttg
tggctgccatagcctaatgtagtcaatacgaaataattgactttttttcttttttaacag
GTGAAGAGCAGAATAAAGAAGCGCTGCAGGACGTGGAAGACGAAAATCAGTGA
gacataagccaacaagagaaaccatctctgaccaccccctcctccccatcccaccctttg
gaaactccccattgtcactgagaaccaccaaatctgacttttacatttggtctcagaatt
taggttcctgccctgttggttttttttttttttttttaaacagttttcaaaagttcttaa

Predicted peptide sequence(s):


>YWHAE_1|GENSCAN_predicted_peptide_1|255_aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ