GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:17:28

Sequence XYLT2_1 : 17519 bp : 57.36% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    860   1141  282  2  0   54   62   178 0.689   9.59
agagtagtttgagaaccacgactctgggagcggcctgaggatgcttaggatgagcgcaga
gcggaaaggaggattcgtgaaggctctctgatgccagtcaaggggttagactttgccccg
caggtgcggcctccaggtttttaagcagacgcctgtggctctcacacgccctctcccaag
GCGGCGTCTCTGGGAGCCCTGGCGTTCCCTGGGCCCCCGGGACCGAGAGCTTACCCGCGT
GGGACTGAACTCGCCCACGACCCCCGACACCAGGCAAGAGAGGTTGTGCCGCAGACCCTC
CACTCCCCAGCACCAGGCGCTCGCCGTCCAGGTGGAGGGGAGCACACGTGGGAGCCAGGG
GCACCGGCGGAGACACGAGCGCAGAAGGCACGCGCTCAAGCCCACGCCCGCGACTGCCGG
GACTGAAGGTGTTGCGAGCCCCGGCTCCACCCCTAGCCTGCG
gtgcgccgtgctttggccccgcaggccccgcccccggccccgccccggcgcgcgcccggc
ccgcctccctaggcgtggaggagggggggcggctcagccccgcgcccgtgcgcgcgctcg
cggccgggttgcagggctgggcgcgcgccccgcgtcccgggcaggaagatggtggcgagc

 1.02 Intr +   1306   1444  139  1  1   60   32   276 0.990  20.85
ccacccctagcctgcggtgcgccgtgctttggccccgcaggccccgcccccggccccgcc
ccggcgcgcgcccggcccgcctccctaggcgtggaggagggggggcggctcagccccgcg
cccgtgcgcgcgctcgcggccgggttgcagggctgggcgcgcgccccgcgtcccgggcag
GAAGATGGTGGCGAGCGCGCGAGTGCAGAAGCTGGTGCGGCGCTACAAGCTGGCGATTGC
CACGGCGCTGGCCATCCTGCTGCTGCAGGGCCTGGTAGTGTGGAGCTTCAGCGGCCTGGA
GGAGGACGAGGCGGGCGAG
gtgctccgacggccgggcgggcgggcaggccgggcgcgggggcgcgcggggtcctggcgg
ggctgcgggcggccccagccggggaagtggggcacgggccgcgtgcgtgcgtgcggggcg
ccggcggtcgcccagagcggagcatccggcccccggcactcccttccccagcaggcctag

 1.03 Intr +   2429   2520   92  1  2  109   46    52 0.295   3.05
ctcttccccgatgtggtttcagcgggaggctcagacacctcagcggtgtggtgaggaagg
gtccattgggtctgggttcgtgctgcggagatggagaggacaggccacaccacagcccta
agctgtggcccagaggtcaggacctccctgcccccagcgcccctgttctgctgcctccag
GGCTCCGGGTCAGAGACTCTATCTGCTGCTGTCCTCCGGCAAGCCCCGATACCCGCGACC
CCTTACCGCATCTCGCCAGTCTGGAAGGCCTG
gtgtggagacagaagagctgcccttgcctttttttgggagaacccagagggtgggatggt
gatgggggctggaacagagtcacatgagaccataactccaaaaggaggtgggggcggggg
tggggctggctccgtgacatccgtggggtgtagacctacaagtaggacaagcaagtagga

 1.04 Intr +   7398   7434   37  0  1   80  105     4 0.024   0.70
gtgcttcaagcaagacagagtggtccattaagtcacgctgctgaaaggccaagaaagaag
aggacttagtcctggagaacttgtgagcatggaggggaaggcccgtgggagagggtttac
aaggctggagacggctctccctagctgcagtgtctcatgctcagttgttactccttacag
CTGGGGGAGCATGCTCAGAGAAGTTAGGGAACTGCTG
gtgagttggcagagctaggcccagagccctggaggctctagagtgttcacatggtggccc
ctgttcctccgtccattctacatctcatccatcagacaccagctaggtgtccgtgtgtgc
cagctgctctgctgggccctggagagatggagctgacatgtctctcatcaaggagttcac

 1.05 Intr +   8799   9291  493  2  1  116   81   455 0.493  41.53
gccagggaggtgctcccatggtggtactgattgtgcggagtccttaggtgaaaagcgctt
ctctgggtaaaaggtgggcaggaacatctaggtctgagggtgcccccaaccaagatggaa
ctcaaggaacaggaggaggtgagggtctgccccagtgatgtgtctgcatctctcttacag
AAAGGAAGGCAGAGGAAGCCACGGCCACTGGACCCTGGCGAGGGTTCCAAGGACACAGAC
AGTTCAGCAGGGCGACGGGGCAGCACAGGCAGAAGGCATGGGCGCTGGCGGGGCCGTGCT
GAGAGCCCAGGAGTGCCCGTGGCCAAGGTGGTACGGGCAGTAACCAGCCGGCAGAGAGCC
AGCCGGCGGGTCCCACCTGCCCCACCCCCGGAAGCCCCAGGCCGCCAGAACCTGAGTGGG
GCAGCAGCTGGGGAGGCGCTGGTAGGGGCAGCTGGCTTCCCACCACACGGAGATACAGGG
AGCGTGGAGGGCGCCCCCCAGCCCACGGACAATGGCTTCACCCCCAAGTGCGAGATCGTG
GGCAAGGACGCACTGTCTGCACTGGCCCGGGCCAGCACCAAGCAGTGCCAGCAGGAGATC
GCCAATGTGGTGTGCCTGCACCAGGCTGGGAGCCTCATGCCCAAGGCTGTGCCCCGGCAC
TGTCAGCTGACTG
gtgagggacaggggtgctccagcccttcccaggcgggggcaggggggtggcatggcccgg
atcctcacccctatctctctgaggaagaaagagccaaggggatcctacctccctgcctaa
gtcttcatccagtgtacttactaagtggcagaggcagagtggggacccacgagcatggag

 1.06 Intr +   9577   9752  176  2  2   79   79   309 0.995  29.96
tacctccctgcctaagtcttcatccagtgtacttactaagtggcagaggcagagtgggga
cccacgagcatggagctccaagtctaggtttcttcggaaggcaggcagctccctcttccc
atctcacccccaccctgtgacctagggtgggcctcgccaacgcctgtcctctgctctcag
GGAAGATGAGCCCCGGCATCCAGTGGGATGAGAGCCAAGCCCAGCAGCCCATGGATGGCC
CCCCGGTGCGAATCGCCTACATGCTGGTGGTTCACGGCCGCGCCATCCGCCAGCTGAAGC
GTCTCCTCAAGGCCGTTTATCACGAGCAGCACTTCTTTTACATCCATGTGGACAAG
gtactgtggtggggagaggccaaggggtctgggatgagcagagcagaaacagaaggttgc
agacagacagagtctctgacctggcccaggtagcctaggagggaaactgaggccctgaac
aggggagtggcagcacgagccagctcagccgcttaggggctggagccctgccctgtgctt

 1.07 Intr +  10023  10225  203  2  2   67   64   279 0.999  22.70
tagcctaggagggaaactgaggccctgaacaggggagtggcagcacgagccagctcagcc
gcttaggggctggagccctgccctgtgctttcctcgtcttgtgtcccttcactctgtcct
ggggtgggattggggatggcgataacactggaggctagctgagtgtctcctccccaccag
CGTTCCGACTACCTGCACCGGGAGGTGGTGGAGCTGGCCCAGGGCTATGATAACGTGCGG
GTGACGCCCTGGCGCATGGTTACCATCTGGGGCGGGGCCAGCCTCCTGAGGATGTACCTG
CGGAGCATGCGGGACCTGCTAGAGGTGCCTGGCTGGGCCTGGGACTTCTTCATCAACCTC
AGTGCCACTGACTATCCAACCAG
gtgtggggatggggctctgagtcctctgcatgggaggggacccctgtctgggcacctggg
gttggagggctttggtggaccttctctgccccataagcgtaactctgggatccgccctgc
tcagacatgggcccctgggccccagctatgttttaggggaggggttggtgtaagatgatc

 1.08 Intr +  10670  10750   81  2  0   83   94   105 0.999  10.51
aggaaggatggggtggtcttcctcaggggcctctggtgctcaccaccccagacatcagcc
aggggtagggcacatggccagccagcaatcaggcagagaagaaaagccagaaggtccgct
ctgggccagtgactgagcaactatctcatgtggctgcctgtcaccccattccttcaccag
GACCAATGAGGAGCTGGTGGCATTCCTATCCAAGAACCGGGACAAGAATTTCCTCAAGTC
ACATGGCCGGGACAACTCCAG
gtgagggggtggggaaggaggccctggccccagagtcttgtcccaacccctcccacacag
ttgggctcggtggctccagccctgggtttcaaagcctccacaccagtcacaggttgagga
gtgttggttgccaggcgggtgaaagagcttagaccccaccctgcaggatccccagccatg

 1.09 Intr +  10950  11166  217  0  1  109   90   346 0.994  36.63
ggccctggccccagagtcttgtcccaacccctcccacacagttgggctcggtggctccag
ccctgggtttcaaagcctccacaccagtcacaggttgaggagtgttggttgccaggcggg
tgaaagagcttagaccccaccctgcaggatccccagccatggcctctctgctgcccacag
GTTCATCAAGAAACAGGGCCTGGACCGGCTCTTCCATGAGTGCGACTCACACATGTGGCG
CCTGGGCGAGCGGCAGATCCCAGCAGGCATTGTGGTGGATGGCGGTTCTGACTGGTTCGT
GCTGACACGCAGCTTTGTGGAGTATGTGGTGTACACAGATGACCCGCTTGTGGCCCAGCT
GCGCCAGTTCTACACATACACACTGCTCCCAGCCGAG
gtgggtagcccagcaggcatgaaggccagggagggcgtgggttgggctgcctgcagctca
ccttccactctcccttgctgcttgcagtccttcttccacacggtgctggagaacagcctg
gcctgtgagaccctcgtggacaacaacctgcgggtcaccaactggaaccgcaagctgggc

 1.10 Intr +  11254  11430  177  0  0  101   49   404 0.999  39.12
acacgcagctttgtggagtatgtggtgtacacagatgacccgcttgtggcccagctgcgc
cagttctacacatacacactgctcccagccgaggtgggtagcccagcaggcatgaaggcc
agggagggcgtgggttgggctgcctgcagctcaccttccactctcccttgctgcttgcag
TCCTTCTTCCACACGGTGCTGGAGAACAGCCTGGCCTGTGAGACCCTCGTGGACAACAAC
CTGCGGGTCACCAACTGGAACCGCAAGCTGGGCTGCAAGTGCCAGTACAAGCACATTGTG
GACTGGTGTGGCTGCTCCCCCAACGACTTCAAGCCACAGGACTTCCTCCGGCTGCAG
gtgcttgcccgaggccccaaggcccctggctaggtcttctcccctggcttttcaccagga
aaatggcagggtgggccagtaagagaatctggggggccacggcctgcagcaaccctcagg
ggtctggggctacaacagcagcaggaaaagccgcaggaggctgagctctaggcagtgctg

 1.11 Intr +  11680  11942  263  0  2  107   94   305 0.996  30.53
ggtgggccagtaagagaatctggggggccacggcctgcagcaaccctcaggggtctgggg
ctacaacagcagcaggaaaagccgcaggaggctgagctctaggcagtgctgaggggccag
ccccaccatgccctctggggcttccagagcccttcaccctccttgcctctcccactccag
CAAGTCTCCAGACCCACCTTCTTCGCCCGGAAGTTCGAGTCGACTGTGAACCAGGAGGTG
CTGGAAATCCTGGACTTCCACCTGTATGGCAGCTACCCCCCCGGCACGCCAGCCCTCAAG
GCCTACTGGGAGAACACCTACGACGCGGCTGATGGCCCCAGTGGGCTCAGTGATGTCATG
CTCACTGCTTACACAGCCTTCGCCCGCCTCAGCCTGCACCATGCCGCCACTGCTGCACCC
CCAATGGGCACCCCACTCTGCAG
gtgagacccccttctgacatacagcaggcccttggggtgtggtgccctagggggaggcca
accagagagtgacgtcccctgcccacaacaaggccccagtctgaagcagggaaaaatgca
aataccgaaaagacggctagagccaggcatgcaggtgctgtgggggtgagatctggggaa

 1.12 Intr +  12226  12421  196  1  1   72   59   138 0.892   9.93
aagcagggaaaaatgcaaataccgaaaagacggctagagccaggcatgcaggtgctgtgg
gggtgagatctggggaaaggaagtgcctggggatgggactccccagagccccctccctgg
gactccaggccaagtcaggtgtgctgatggcatctccctttctccctgctggcaccttag
GTTTGAGCCCAGGGGCTTGCCGTCCAGCGTGCACCTGTATTTCTATGACGACCATTTCCA
GGGCTACCTGGTGACGCAGGCGGTGCAGCCCTCAGCCCAGGGGCCGGCAGAGACGCTTGA
GATGTGGCTGATGCCCCAAGGGTCGCTGAAGCTGTTGGGGCGCAGTGACCAGGCCAGCCG
GCTCCAGAGTCTGGAG
gtgggacaggtcccccacttgctttctcccaacccccacccagacttggggtagtgggaa
gagagggacagacaccaagggaggggtaaggttatttttcccagtcatggcagccatggt
gatgcccccatgcagacatcctgtgtcaccccccagcctgtgcacactgaggagcacctc

 1.13 Intr +  13376  13709  334  1  1  128  121   380 0.977  41.73
tctcagagctgggagagatattaaaggtctcctagtctgaccccttcattttgcagatgg
ggaaactgaggcccagaaagagacagtgactggcctgagattacacagtgagaggcagct
tcagaggagggagaaggacctttcccccacactcctgcccagctgcctctctctctacag
GTTGGCACTGATTGGGACCCCAAAGAGCGTCTTTTCCGGAACTTTGGGGGGTTACTGGGG
CCGCTGGACGAGCCTGTGGCCGTGCAGCGCTGGGCCCGGGGCCCCAACCTCACAGCCACA
GTGGTCTGGATCGACCCAACCTATGTGGTGGCCACATCTTATGACATCACAGTAGATACG
GAGACTGAGGTCACGCAATACAAGCCCCCACTGAGCCGGCCCCTGCGGCCAGGGCCCTGG
ACTGTTCGACTCCTTCAGTTCTGGGAACCGCTGGGTGAGACCCGCTTCCTTGTGCTGCCC
TTGACCTTCAACCGCAAACTACCTCTCAGGAAAG
gtaagcgtgcagttctcaaatgaggcccagaagccagacagaataggactcgccagagag
gtgacctcaagaagccaaccatcagagctgactcccatccctagagtcagggaagcatgg
aagggctggggccttcatcttctttcctgtagcatgcagggtcctgcactgcagtgtggt

 1.14 Intr +  15138  15321  184  1  1   81   38   157 0.390  10.05
ttataaaactcagttttataggcacagaaagtcccttggattagcccaaggtcattcagc
aagctgtgactcagaagtagggctgtgacaggaactggggtacccagacccaactcctgg
gtctggcctccacggagtctgttgcagggggtgtgcttactgcctgctctgcacccacag
ATGATGCCAGCTGGCTGCACGCAGGGCCACCCCACAACGAGTACATGGAGCAGAGTTTCC
AGGGCCTGAGTAGCATCCTGAACCTGCCTCAGCCGGAGCTCGCGGAGGAGGCTGCCCAGC
GGCACACACAGCTCACAGGCCCTGCGCTCGAGGCCTGGACAGACAGGGAACTGAGCAGCT
TCTG
gtccgtggctggactgtgtgccataggcccctctccctgcccctccctggagccctgcag
actgaccagctggagctctctgtcccccgaccccaaatcagagctggggcctgtcaaagc
agacgggcgactcaggtagcagggccccagccagtacccgtggaggacccgggaaattgc

Predicted peptide sequence(s):


>XYLT2_1|GENSCAN_predicted_peptide_1|959_aa
XRRLWEPWRSLGPRDRELTRVGLNSPTTPDTRQERLCRRPSTPQHQALAVQVEGSTRGSQ
GHRRRHERRRHALKPTPATAGTEGVASPGSTPSLRKMVASARVQKLVRRYKLAIATALAI
LLLQGLVVWSFSGLEEDEAGEGSGSETLSAAVLRQAPIPATPYRISPVWKACWGSMLREV
RELLKGRQRKPRPLDPGEGSKDTDSSAGRRGSTGRRHGRWRGRAESPGVPVAKVVRAVTS
RQRASRRVPPAPPPEAPGRQNLSGAAAGEALVGAAGFPPHGDTGSVEGAPQPTDNGFTPK
CEIVGKDALSALARASTKQCQQEIANVVCLHQAGSLMPKAVPRHCQLTGKMSPGIQWDES
QAQQPMDGPPVRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSDYLHREVVELA
QGYDNVRVTPWRMVTIWGGASLLRMYLRSMRDLLEVPGWAWDFFINLSATDYPTRTNEEL
VAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDW
FVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSLACETLVDNNLRVTNW
NRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQVSRPTFFARKFESTVNQEVLEILDFH
LYGSYPPGTPALKAYWENTYDAADGPSGLSDVMLTAYTAFARLSLHHAATAAPPMGTPLC
RFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWLMPQGSLKLLGRSDQAS
RLQSLEVGTDWDPKERLFRNFGGLLGPLDEPVAVQRWARGPNLTATVVWIDPTYVVATSY
DITVDTETEVTQYKPPLSRPLRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDA
SWLHAGPPHNEYMEQSFQGLSSILNLPQPELAEEAAQRHTQLTGPALEAWTDRELSSFX