GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:06:46

Sequence WNT9B_1 : 27869 bp : 52.09% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1238   1314   77  1  2   90   60   285 0.999  24.41
cggtggggccaatggggcggggggctcgccgcccggggctggggagcctcccaatctcct
cctttcccagcgccgcctgccccgccccacccgggtttaaagtcccgcgggcgggtggtg
gcggagctgcgagcttgagcggcgcgaggagatgctagagggcgcagcgccgccagcacc
ATGCGCCCCCCGCCCGCGCTGGCCCTGGCCGGGCTCTGCCTGCTGGCGCTGCCCGCCGCC
GCCGCCTCCTACTTCGG
gtcagtgcccgccgcgccccccgcccgctccccggcctgcctgtctctccctcctgcgct
acagctgggccaatttttccctcccgctgtccttggccccgccgaggtctcgaactcaga
ccctagcccggcgcgacccaacccacttcgcagtcggagttcgcgccctgagttcggtct

 1.02 Intr +   1643   1798  156  2  0   78   35   123 0.063   5.64
cgcagtcggagttcgcgccctgagttcggtctccagcttccccggctccgaatccatcgc
cctgttcagtgtccgagtctctggtcgccccccagccgccgctctcctcatcccgccggg
tctcggactctgcgcacgcctcggaccctggccccgtccgccccggccccgcccgttcag
GCGTCAGTCCCGCTCTCTGATGCCCTCTCGGGATCCTCACGCCGGTGCCCTGTCTGCCGC
CATCCTGGCCTCCGGCGAGCCGTCCTTGCCTCGGACTCCTTCCCCACCCTCCGCCTTCGC
CCTGCGGAGCGGAGACCGAGAGGGCTGGGTGGATGG
gtgggacgggctgttcccggtctcggggcagaggatcgtgcgcgtccagggagaatgggg
gaaacctcggacggtgagagcgccagctggagacgcaggaaggaaccgtgcgctggggaa
atgcgaccacatctcagacctggcatggggtgatttctcaggagaacactggaaagagtg

 1.03 Intr +  13533  13769  237  0  0   50   63   149 0.202   5.86
ctagcctggctgaggggagggtcccctttctccagccctggctggctctggatttaggac
agtcctagtggttctattcccaagggagccgctcacaactacatccatcccagggggtgt
cctggactactctgggggtggatccttgatcaggcagggaggttcctgctgtccctacag
CTGGGCGAAGGGTGTGGGCCATCCGTGGGGCCTGCAGGAGAACAAGTGGAATCTGCAGCA
TGGGACATCTCTGCCTAGAGCCTGTGCAAACAATGGCACTGTCCTCATCATTGAGGGGGT
CACGCACAAGGCATTCCCCAGAGGCCTGGCCCTTCCAGGGCCCAAGCCCAGCCTGAGCCT
GCCTGTGCGTGGGAAGAGGGTGATCGGAGCCCAGGGTGCATTCAAGAACCTGTCAAG
gtagttagttggtcaatgcgtcatggttaaataacttggctgcagtcacccagccagagt
cacccagtaccctggttgggtaggaacttgccaccaggagtgcggtttcagccatgattt
gcctttccctgaacttcccacccactgcctccacatccccacaccaagctcccccaactc

 1.04 Intr +  22116  22372  257  0  2  113   59   209 0.974  18.12
gcaacctttgttacatgaaccttggtttcctaatctgtaaaatggggacgggacctccag
cgggtcagcctgctgcccagaagggcagtaaatgaagcccctgaggaggccccttccctt
catttgcccctcaccaccatccccaaggctcacctgtctccctcctctcgctctctctag
CCTGACCGGGCGGGAAGTCCTGACGCCCTTCCCAGGATTGGGCACTGCGGCAGCCCCGGC
ACAGGGCGGGGCCCACCTGAAGCAGTGTGACCTGCTGAAGCTGTCCCGGCGGCAGAAGCA
GCTCTGCCGGAGGGAGCCCGGCCTGGCTGAGACCCTGAGGGATGCTGCGCACCTCGGCCT
GCTTGAGTGCCAGTTTCAGTTCCGGCATGAGCGCTGGAACTGTAGCCTGGAGGGCAGGAT
GGGCCTGCTCAAGAGAG
gtggggaggagggctaggggacggggagggctgggggaagaagccttcagggaggaggag
gctgggagaggctgccctttcctttttcctggctcccgtgcccaggccacactgcccttc
ctgccctagcacggtcccaaatgagaagagtcacaagagttaatgaggggcagttgaagg

 1.05 Intr +  24700  24965  266  2  2   66  105   353 0.994  32.57
ggcagttgacagggagacccacccggagctgtgtcctcaagccacattctcttgtcctgc
ccatcacagcgctgccaccaccgcctctggccctcagagggcggcaggcaacctctaagc
ttcctcctttcctctcttccccctttcctccctccctatgcccctgggtgcccgatccag
GCTTCAAAGAGACAGCTTTCCTGTACGCGGTGTCCTCTGCCGCCCTCACCCACACCCTGG
CCCGGGCCTGCAGCGCTGGGCGCATGGAGCGCTGCACCTGTGATGACTCTCCGGGGCTGG
AGAGCCGGCAGGCCTGGCAGTGGGGCGTGTGCGGTGACAACCTCAAGTACAGCACCAAGT
TTCTGAGCAACTTCCTGGGGTCCAAGAGAGGAAACAAGGACCTGCGGGCACGGGCAGACG
CCCACAATACCCACGTGGGCATCAAG
gtgagcatgtccctggctgcccgcagtgccttcccaccagggtacacagctggggagcat
ggcttgaaggaggccagcaccccactccccaaaatacatgaagagccgtgaacttcataa
aggcaggatgaacttcacgtcttcaaccagcattcccttggcatctactctgggctgtga

 1.06 Term +  25844  26317  474  1  0  140   47   390 0.920  35.37
tcagtcgcgtaagttgtctattccacaagaactccaggccaaggggaggagctggggctg
agaccctgggtctctttcccattctcctgcctctgccctgctggggttggtgctctgggg
gcaggctctggctgctgggcccaggcctctgaccacgcctctgttctgcctcccccacag
GCTGTGAAGAGTGGCCTCAGGACCACGTGTAAGTGCCATGGCGTATCAGGCTCCTGTGCC
GTGCGCACCTGCTGGAAGCAGCTCTCCCCGTTCCGTGAGACGGGCCAGGTGCTGAAACTG
CGCTATGACTCGGCTGTCAAGGTGTCCAGTGCCACCAATGAGGCCTTGGGCCGCCTAGAG
CTGTGGGCCCCTGCCAGGCAGGGCAGCCTCACCAAAGGCCTGGCCCCAAGGTCTGGGGAC
CTGGTGTACATGGAGGACTCACCCAGCTTCTGCCGGCCCAGCAAGTACTCACCTGGCACA
GCAGGTAGGGTGTGCTCCCGGGAGGCCAGCTGCAGCAGCCTGTGCTGCGGGCGGGGCTAT
GACACCCAGAGCCGCCTGGTGGCCTTCTCCTGCCACTGCCAGGTGCAGTGGTGCTGCTAC
GTGGAGTGCCAGCAATGTGTGCAGGAGGAGCTTGTGTACACCTGCAAGCACTAG
gcctactgcccagcaagccagtctggcactgccaggacctcctgtggcacccttcaagct
gcccagccggccctctgggcagactgtcatcacatgcatgcataaaccggcatgtgtgcc
aatgcacacgagtgtgccactcaccaccattccttggccagccttttgcctccctcgata

Predicted peptide sequence(s):


>WNT9B_1|GENSCAN_predicted_peptide_1|488_aa
MRPPPALALAGLCLLALPAAAASYFGRQSRSLMPSRDPHAGALSAAILASGEPSLPRTPS
PPSAFALRSGDREGWVDGWAKGVGHPWGLQENKWNLQHGTSLPRACANNGTVLIIEGVTH
KAFPRGLALPGPKPSLSLPVRGKRVIGAQGAFKNLSSLTGREVLTPFPGLGTAAAPAQGG
AHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLL
KRGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYS
TKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLS
PFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPS
FCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQE
ELVYTCKH