GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:06:22

Sequence WNT3_1 : 56622 bp : 54.18% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.09 Intr -   1186   1107   80  1  2   47  116    69 0.258   4.44
 1.08 Intr -   1468   1332  137  2  2    2   75   157 0.067   6.60
 1.07 Intr -   4740   4601  140  2  2   75    4   104 0.046   1.32
 1.06 Intr -   5560   5470   91  2  1   88   72    41 0.047   2.05
 1.05 Intr -   8641   8602   40  1  1   90   80    35 0.043   1.18
 1.04 Intr -  12127  12050   78  1  0  108   87     9 0.105   3.04
 1.03 Intr -  12891  12833   59  1  2   79   59    34 0.064  -1.31
 1.02 Intr -  15191  15111   81  0  0   50  113    25 0.136   1.31
 1.01 Init -  19127  18965  163  2  1   55   62    67 0.215   0.67
 1.00 Prom -  21005  20966   40                               0.19

 2.06 PlyA -  21307  21302    6                               1.05
 2.05 Term -  26294  26175  120  2  0   42   55    78 0.083  -1.32
 2.04 Intr -  30457  30259  199  0  1   93   60    81 0.796   5.68
 2.03 Intr -  34161  34037  125  0  2  103   45    60 0.546   3.09
 2.02 Intr -  37169  36887  283  1  1   59   51   145 0.222   5.86
 2.01 Init -  38959  38895   65  1  2   67   75    57 0.192   2.87
 2.00 Prom -  39356  39317   40                              -7.40

 3.01 Init +  43265  43317   53  1  2   99   87    -6 0.072   0.98
agtgattgcagggctgtgggggcagctggcacagcagggctgggctggagatgctgctta
agagcacgggaggggcagcctgagcccagagggaggctcaacggggacctttgcagcctg
gcagacagggcagggtacttagctccctggcctcagtttccttatcttggaaatgggaca
ATGGCGATGATAATGAAGTTTTTATTACAGACCTGCCGTGAGGATTACATAAG
gtaacagacacaagcactcagaactgtgtccagcacatgataggcccataataaaccaca
gggattatatgatcactctaacctgcttctaacagggcaggggcagtgctgtgtgcgccg
tgtgcccatcagggctctgggctcactgactctacccactcaggcatgtgctcagtatgg

 3.02 Intr +  45844  46085  242  1  2  115   79   394 0.839  38.93
tcagagctctgcgctttgaggggcggcatgctcccgaggtcaaaggtagcacattcaggt
gccagggcacaggccctctgcctctccacctaccccggagggttcacaaagcggccatgg
tgcccaggatgggctctgtgctttgtgcccacagtgttactaccctctgtctgcctgcag
GTCCCTGGCCCTGGGCCAGCAGTACACATCTCTGGGCTCACAGCCCCTGCTCTGCGGCTC
CATCCCAGGCCTGGTCCCCAAGCAACTGCGCTTCTGCCGCAATTACATCGAGATCATGCC
CAGCGTGGCCGAGGGCGTGAAGCTGGGCATCCAGGAGTGCCAGCACCAGTTCCGGGGCCG
CCGCTGGAACTGCACCACCATAGATGACAGCCTGGCCATCTTTGGGCCCGTCCTCGACAA
AG
gtactgccttggggctgagggggggggaggggctgggtggggggagggatcaggactgta
tgcccttccaccccagtcagggtgcctcttctctgaagccagggtccctctgggagggtg
ataaatttggttgcatgactgccacaccttcccaggcgctgctgggggctgggccgcctt

 3.03 Intr +  49700  49965  266  0  2   94  101   408 0.999  40.47
ccaactgggtctaaaccagccaaagagggtggggaagctgcctccctcttgcctcagggc
tggtgagctcttcaactcttcctggcctcgttcccctcacgtcctggcctgggaggtgga
ggcagggcaggcgctcccaggccgggtcctgagtgctgcctccccacgacctccccgcag
CCACCCGCGAGTCGGCCTTCGTTCACGCCATCGCCTCGGCCGGCGTGGCCTTCGCCGTCA
CCCGCTCCTGCGCCGAGGGCACCTCCACCATTTGCGGCTGTGACTCGCATCATAAGGGGC
CGCCTGGCGAAGGCTGGAAGTGGGGCGGCTGCAGCGAGGACGCTGACTTCGGCGTGTTAG
TGTCCAGGGAGTTCGCGGATGCGCGCGAGAACAGGCCGGACGCGCGCTCGGCCATGAACA
AGCACAACAACGAGGCGGGCCGCACG
gtgagcccggctaccctccccaaacccttcagggagcagccccccgcttcccctccggag
ctgccctggcccccacctcaccccttccggcagccctgtgggtcgcgggctccttttccc
cttggccaggcttggcctcctccccaccccacagccacttcgtctgtccaccctccttcc

 3.04 Term +  50948  51427  480  1  0   92   49   758 0.998  67.48
ggggagggaaacatggtcactattctttaggtcttgcctcagtccccatcagttctcttc
ctgtcacagaggagtagagaaggctggagggaagggggtgggcagtggcagagagggaag
gcctggatgtgccccctcgtggggtcggtctgttggccagctgccacttctctcccccag
ACTATCCTGGACCACATGCACCTCAAATGCAAGTGCCACGGGCTGTCGGGCAGCTGTGAG
GTGAAGACCTGCTGGTGGGCGCAGCCTGACTTCCGTGCCATCGGTGACTTCCTCAAGGAC
AAGTATGACAGCGCCTCGGAGATGGTAGTAGAGAAGCACCGTGAGTCCCGAGGCTGGGTG
GAGACCCTCCGGGCCAAGTACTCGCTCTTCAAGCCACCCACGGAGAGGGACCTGGTCTAC
TACGAGAACTCCCCCAACTTTTGTGAGCCCAACCCAGAGACGGGTTCCTTTGGCACAAGG
GACCGGACTTGCAATGTCACCTCCCACGGCATCGATGGCTGCGATCTGCTCTGCTGTGGC
CGGGGCCACAACACGAGGACGGAGAAGCGGAAGGAAAAATGCCACTGCATCTTCCACTGG
TGCTGCTACGTCAGCTGCCAGGAGTGTATTCGCATCTACGACGTGCACACCTGCAAGTAG

ggcaccaggtagggctccgggaagcaggggggaggctgggagcctgggcgcagggaatgg
ggttgtttgcccatctcgtcttcttgacgacccccttctgtttctaagctatccaagaca
cacaagttcccacagccaaaataggaagctaggatttttcaagcatccgtgggaatggtc

Predicted peptide sequence(s):


>WNT3_1|GENSCAN_predicted_peptide_1|290_aa
MRIQLEQGDKSLGPAGDSQQCPFIPQPVFEDPLCALCYVWWYGLKDDGELVLPTGNSVAI
GLAGSCRKAGKRSEEEEQVVKEWGLALTMAAGDGSSSVGERKGFEEVDSKCVSQRQVFIE
DPLCPGQARLQKGNADVNSAAKCDPIGRIPTDRPPILLPLDSEAPPIMGAGAPKKKKKDK
FLHQELTGTDKGNSRNQCCCFLSRLCHYLENISSFQGSGAPTFPGRGGETGPRADKRRVL
PPNWVASEDPGATEQEAEEQPEQPPPSRAQRGAAGFEDVSEQPISARGLX

>WNT3_1|GENSCAN_predicted_peptide_2|263_aa
MGTPTDTCTPVFTAVLLTAAKRSRSRSGLADVRTGSLASSGACVHTVGLGLVGSDAPNYT
HSDEAITAVDEGGHRPGLEPLTWLLGRELVTKPEKPSSGFQLPLFLALLEHMCTLRLLKV
PFQGHEGPSEEVAQLSCQGPPESPGGPWFWAAVGRRKGKPRTVPDQLATGVRDAGYTLQQ
ITWGGFEKYRHPGSNTSVAGSEPLERSPGNWIIKSLHQKCDSRMSFFFRMLVQIFRTGGP
FLCVSDKAGPTPKALQEERRPPT

>WNT3_1|GENSCAN_predicted_peptide_3|346_aa
MAMIMKFLLQTCREDYIRSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSV
AEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTR
SCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKH
NNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKH
RESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDG
CDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK