GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:58:43

Sequence USP6_1 : 49037 bp : 44.70% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1542   1731  190  0  1   65  109    80 0.412   7.39
atgaggaactgggtgcacacatgagtggggcagccgggcctggccagagaagcaacacac
acgtgcacagacatgtttatccacatacacatgtgcacgcatgtgcacaaacacattgca
ggcaggcatgttgacgcctcaggcagcggaggaccctgactctgggccctgctgacccag
GCAAGGCCCCATTGTGATGCGTGCCATGACCTCAGAATGTCACTGGTGCTTAGCACCTAT
CCGCTCTCCAGACTGCGTCTGTGTTCTACGGCAGTTACACACACGCAGTGGTATTCACAA
GCGGTTTTGTGGACTCAAAGGTTTTCTCCCTGAGAGGCATAACCCAGGCCAGCTGATTCA
TCAGAATCAG
gtgagtgtgacctgctctcttccctccaggctgacttggggacagtggctatggtatggg
cggtgttggcctctgggcagctacagaggagggtcatccctgagcactcaccgggcgccc
gttctacactgcccatgtagacgattttctctttcgtcttcatggtggcttcgtagagtg

 1.02 Intr +   1908   1942   35  2  2   37   99     2 0.526  -6.78
tcaggtgagtgtgacctgctctcttccctccaggctgacttggggacagtggctatggta
tgggcggtgttggcctctgggcagctacagaggagggtcatccctgagcactcaccgggc
gcccgttctacactgcccatgtagacgattttctctttcgtcttcatggtggcttcgtag
AGTGGGTGCTGTTCCCGAATGTACCCATTCGACAG
gtgagccgtctggggtcagagaggcagtaactggcctgggaatccagacaagaccctggg
ttttgctctcagccctgctgtgtgccatgctagacttcaggcctcaaccctgagacctcc
ctgctctagatcccaaatctgcccagatttccgatcccaatggggcagagcctggccctg

 1.03 Intr +   2745   2870  126  0  0   68   43   110 0.602   4.29
tccatgagcacagtggctgctttggagacagtaatcattttcatccccaaaaccaaacac
actcctgctcaaatggtgttattgctaaagcagcttcactggttagactgaagggccatg
gtagcccaagtgatgagcggggtagaatggagcagtcaggagagatcttgttccccgtag
GAAACTGGGCATCTCTGTGGCCCTGAACATCCCAGGAGGCCGATCGTACAGAGACCTCTG
GTGCCTGACCGCAGTTCACATCCACATCCCTGGAATAGACCATCACAGGCTCTTCACCCT
TGGCAG
gtggacaccattcaacctgccggggcaggtgtgtgcccatttcatggcatatggggacaa
ccggattctctgtccaggtcccactcttctcgagtccttgggaagatgcccacccctgct
tggggcttcagactgcagagacccatggaggtgtgggccatggggtttggccccttttta

 1.04 Intr +   3176   3248   73  2  1   83   87    72 0.722   6.01
cttcagactgcagagacccatggaggtgtgggccatggggtttggcccctttttaccgga
gtgcagtggtggaatgaaggttatacaaccagccagcatctgggagcccggtgggagcgg
ttcaggtgttctccgaagctgtcgggtacagtgtaacctttagacaattttgtctcacag
GATGGACATGGTAGAGAATGCAGATAGTTTGCAGGCACAGGAGCGGAAGGACATACTTAT
GAAGTATGACAAG
gtacagttcggtctgctccttggagggaggcctcttccagtgcgccctggtcaaagggtc
ctgggttccctaggagcacagggcagggacgggtggccaatacccccaggcccttgcacc
ctttaccttggacccctcaccaaggctccctctgggttacagggacaccgagctgggctg

 1.05 Intr +   3411   3493   83  2  2   95   73   126 0.990  10.24
cttatgaagtatgacaaggtacagttcggtctgctccttggagggaggcctcttccagtg
cgccctggtcaaagggtcctgggttccctaggagcacagggcagggacgggtggccaata
cccccaggcccttgcaccctttaccttggacccctcaccaaggctccctctgggttacag
GGACACCGAGCTGGGCTGCCAGAGGACAAGGGGCCTGAGCCCGTTGGAATCAACAGCAGC
ATTGATCGTTTTGGCATTTTGCA
gtgagtcatcctctatgctcccctcacccctaaagcagctgtctcagctcagggatgggt
ttgcttttagaaaggcctttctgatgcaggacatgtctcgctaggtcgggccaacctctt
ttccagggtcagaactcctccctggctcccctgcaggtccagcccgaggttgttgttagg

 1.06 Intr +   5205   5244   40  0  1   79  116     5 0.907   0.63
ctgcccctcctgggagtcagagccacaggaaggcccttgtcctcccttccctgtgccttc
tcccgggctgagccctgagctggatagggacagagccagtcctttctgggggtcggctcc
caggcttgggcggctccaggccctgtgcacgtcctcagctctgcctgggttgccttacag
TGAGACGGAGCTGCCTCCTGTGACTGCACGGGAGGCGAAG
gtaagagcctgatgcgtggaggggctggtccagggacgtagggactgggcgggtggtcag
tgaggcagaggaagcagctggcctgggcggtggcgggtgagggcaacacgctgtcactgg
gaggggcagcagagacctgaccccaagttgctgtaactttggcagtttgataaaattcca

 1.07 Intr +   6252   6359  108  2  0  113   85   160 0.974  18.68
tttagactctgagtgtccatccactctttcagtcctgggaagggagaccctgtcccagct
tgatctcgcctctactgaggaatcatggggccaaaactgacaatttccagaatccccagg
ctctggtcctcactggggtcaccccatggcctgtgacaccagattcttttctgcccacag
CTCATAGATCGAGTGTACAAGGGAATTCCCATGAACATCCGGGGCCCGGTGTGGTCAGTC
CTCCTGAACATTCAGGAAATCAAGTTGAAAAACCCCGGAAGATACCAG
gtatgctcagccagagcacaacaaacaggacaggccgtgtcaggggcccaggtctccagc
tggagggaacgtcaagcccaccctggggtgggggggtgggaggggatggttagatgcaca
tcctgggcatggacggtgacacagtcaccacagacaaactcggctgtggtgaccctccct

 1.08 Intr +   6696   6805  110  2  2   97   82   138 0.999  13.18
aactcggctgtggtgaccctccctggcctcagtagcaagccaaaaagcagctttctgcag
aaggaaaccttccttctttccttccttcccgaagtgctgactgtgggctgactgccattt
ggggcagggagtcttccatctgttctgaggctgcttcctcctcttggccctgccctacag
ATCATGAAGGAGAGGGGCAAGAGGTCATCTGAACACATCCACCACATCGACCTGGACGTG
AGGACGACTCTCCGGAACCATGTCTTCTTTAGGGATCGATATGGAGCCAA
gtaagcctacgggagccacacagtcccagcagagatggggtgaacgagagggatggggac
ttccccggagcagaagccagggtcacccaggagggatgacagagctgccaagagctctcc
tggcccagggagcagccggcaccatgaaccgagcacctccctggttccaagccctgggcc

 1.09 Intr +   8043   8091   49  0  1   91  117    57 0.991   7.58
gcatgtcacagatgtggattttactgaaacatttcttcaacagtctcaggccctgaagag
ctcactgcttatctggtgaatcatctgaacctgaaatgggatttgttaggatttgtagac
aaagtgaaactaacagcatctgcacaaaccaaaccatagccccctttctgtgtttcctag
GCAGAGGGAACTATTCTACATCCTCCTGGCCTATTCGGAGTATAACCCG
gtgagtattcccggcagtgaggttcccaggctgtatttccatattcacaggagtgggtgt
ctggtgggggtgtcgttgcttcttttaaagttggtatttgtgactcaccaggatatagga
ggtaggattctaggtcaccgctggcataaacctccaagcaagggggtggtctcaaggggt

 1.10 Intr +   8617   8737  121  0  1   92   96   113 0.985  12.57
aggtgctgaagtgcctgatggactttgctcttgtcatgaaatgaatttgcatcctgagga
agcctcttcttcagaggaagcctccccagtcacctctgccctctccaatgacatgagtcc
tcccaggtgacctcagccctcccaggtgatgtccttccatggtgactctggctcttgcag
GAGGTGGGCTACTGCAGGGACCTGAGCCACATCACCGCCTTGTTCCTCCTTTATCTGCCT
GAGGAGGACGCATTCTGGGCACTGGTGCAGCTGCTGGCCAGTGAGAGGCACTCCCTGCCA
G
gtaggtgaacagctgcccgtggggcctcacgcagccagacccgggaaagccactgtggcc
aggtgatctcggctttcagccaaggcacactccttgtgttgccagcttgttgggagcatt
taggacgtctctgctgagggtcccacaggagtccgcagctgacccccacaacccaagtca

 1.11 Intr +   9052   9317  266  2  2   99   54    43 0.571  -0.77
tgagggtcccacaggagtccgcagctgacccccacaacccaagtcagatgcctttcatcc
ccatcagcagagggcatctcatcctccccatggccaccctctgtgtcctggagccacatc
ctccggctctgattctgttcagctgactctcccctccctgagggtcctcctgccctccag
CTGCCTGGGCTCCTGCTGCCCTTGGTGCCCACAAATGGGCTGACCAAGCCCAGGTGGCAG
CATCTCACCATCCCGTGTCCCCTGGCCCGACCCCACTTCCAGGAGATGACCAGGAAGCTC
AGCACCCACCCTGTTCTGGCCGCTCTGTTGTGGCCTCAAAGTCAGGCTTGCCCTTTTGCA
CCCTGGCCCAGGAGGCTTCCAGGGGAACCTCCAGCCAGGCTCCAGGGGATGTTCCTGTCC
CACCTCCCCAGGGCAAAGGCCGCATG
gtagggtcaccagatgggagggcgggaggccttggggtttgggggcctctgcagctgccc
agctctttcagctgatggctccacaccttgggggaaggctctgatttcatgatgggctgg
gggcttctcaggattccacagcccaaatggtgggacagtccaggggctccaagaccaaca

 1.12 Intr +  10460  10559  100  1  1   95   89    44 0.970   4.88
aaatgagtacccccccatgagaagttgcaagaccttttctgactcagcattctggagggc
tcaggtgaccctcatggggaaggtcactgactctggagactgaagccccagtgtgcgcag
ctcgagccaccagccccagcctggaagggccaggttctctcatacctgctgtccccacag
ATCTCTCTCGGGCTCACCCTGCGCCTGTGGGACGTGTATTTGGTGGAAGGAGAACAGGTG
TTGATGCCAATAACCAGCATTGCTCTTAAGGTTCAGCAGA
gtaagtctacgtgtgcccagtggggcctggggagccctgcagtcagaccccgactggccc
aagggcagcttcctcacactgtcctcatgatcctctgttctggcccagagggaggtctgg
ccaggtgggctgggcagggcactgtgacaccgagcccatcccccacatgacccagatgaa

 1.13 Intr +  10930  11082  153  2  0   79   80   163 0.969  14.64
gtggtgagcacttccctgtccagatcaccccccagccacagtctcctgtgtacatctgga
tgcctggggtggccacaaaaggattcggcaccgcccagtgggagactgaagtggccacag
ggtatgagctgtgaccattcccagggaactctcctggcctgatatccaccctgtccctag
AGCGCCTCATGAAGACATCCAGGTGTGGCCTGTGGGCACGTCTGCGGAACCAATTCTTCG
ATACCTGGGCCATGAACGATGACACCGTGCTCAAGCATCTTAGGGCCTCTACGAAGAAAC
TAACAAGGAAGCAAGGGGACCTGCCACCCCCAG
gtgggctccagtgccatgtcccctcccatgtcagcctctggggcagtcaatagtgggcgg
gtgccccggaccagcaaccctactacctgggccttcctcttcaccttttcttcctcctct
tcctcctggactctaagaaagtacaggaggcccaccggtcctcagggcaggcactcagtg

 1.14 Intr +  12064  12483  420  2  0  106   72   110 0.868   5.12
tgccaggcagcacacacccctccctctgggatcagcagactacaggcgtgtcgtcagtgt
cagaccacaggggccacacagagaccccaaggactccagagatgcaggcaggtggggccc
agcccggaaaggcctgcatgggctcactggagatgctgaccacgtctgttttcctttcag
CCAAACGCGAGCAAGGGTCCTTGGCACCCAGGCCTGTGCCGGCTTCACGTGGTGGGAAGA
CCCTCTGCAAGGGGTATAGGCAGGCCCCTCCAGGCCCACCAGCCCAGTTCCAGCGGCCCA
TTTGCTCAGCTTCCCCGCCATGGGCATCTCGTTTTTCCACGCCCTGTCCTGGTGGGGCTG
TCCGGGAAGACACGTACCCTGTGGGCACTCAGGGTGTGCCCAGCCTGGCCCTGGCTCAGG
GAGGACCTCAGGGTTCCTGGAGATTCCTGGAGTGGAAGTCAATGCCCCGGCTCCCAACGG
ACCTGGATATAGGGGGCCCTTGGTTCCCCCATTATGATTTTGAATGGAGCTGCTGGGTCC
GTGCCATATCCCAGGAGGACCAGCTGGCCACCTGCTGGCAGGCTGAACACTGCGGAGAGG

gtgaggttggctttcactgcactgagccacaatgtgggcatggacttcccggccctgcag
tgcacccagcactgattccgaccgggatacctcctttgcagctagggacgagcagcagtg
cgctcccacttcagggccttgcctctgccacctctacttggaaagttctcagttccctcc

 1.15 Intr +  14234  14308   75  0  0   95  110    13 0.887   3.69
cctaatgatgcatttctcagaatgtaacctcatcattaagcaatgcatgtactaaaatta
gctagattttaaaacttccgatttaggaataagatgtctttaaaaaaaaaaaacagaagc
aatcaagtgggtgtaaattagacagataagaaattaacacattcctatctgtccttccag
TTCACAACAAAGATATGAGTTGGCCTGAGGAGATGTCTTTTACAGCAAATAGTAGTAAAA
TAGATAGACAAAAGG
gtaagtctccagtattattttttaaagagattattttaaatgtattttttttcttctttc
aactattaaagtgctaacaacttttggttttctagttcaaaagtaattagggcccttctt
tttcttttttcctgaagcagcatttgatgttggcaaacccaccatcaaattattttctaa

 1.16 Intr +  14812  14950  139  2  1   53   97    32 0.689   0.12
ctgttgccagacataccatgaaaagccttctctagcatttcaaagacctgctagagaatt
attagcaccatttagctgattatgagagttataaaaaatcttttcattgaatataagtaa
ctgtttgtgccatggcatattactacagctaagctttggttctcatattgtttgttccag
TTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAACCTGGGAAACACATGCTTCATGAACT
CAAGCATCCAGTGCGTTAGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGAC
ATCTTTATGAACTCAACAG
gtaaactttcttgagtcactggcctcttaacctgtgactttgatataaacccactatcac
ctaaatttcctcttttttcaccctgcgggagaaagattttatcttatttgccctatttaa
tatgaaataggccaaggaatacatctcttgtttcaaaaagaaaagatattttgatgtgag

 1.17 Intr +  15206  15311  106  2  1   65  102   -22 0.907  -2.88
tttcaccctgcgggagaaagattttatcttatttgccctatttaatatgaaataggccaa
ggaatacatctcttgtttcaaaaagaaaagatattttgatgtgagatgctaggcatcttt
gcccacatgattgtgatttatgagaatctttggcaacaaattttcctctcaaacttctag
GACAAATCCCATTGGTATGAAGGGGCATATGGCTAAATGCTATGGTGATTTAGTGCAGGA
ACTCTGGAGTGGAACTCAGAAGAGTGTTGCCCCATTAAAGCTTCGG
gtaagcaggttaaaataatataaaagtatttaattcctaaatagttgtttaatcattttt
ctctacttgttttttgtgtttagccttttagcttaatgaacgtttttggatcctttactt
ggtataaacaagaggccaaattcttttgcttgtttaaatatttgcaaaatactactgtat

 1.18 Intr +  17499  17672  174  2  0   85   68   191 0.883  16.94
tcatttgacattaagattcaaaagatttcatgattatccaaaatacatttgttgaaatgg
aggcagactaagtactatactatttattttcttacaatggctctgattggattataggac
atgttcattccaaattttatgggtaggaaataatgactgtgacttctcttatatttatag
CGGACCATAGCAAAATATGCTCCCAAGTTTGATGGGTTTCAGCAACAAGACTCCCAAGAA
CTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCTCAACCGAGTCCATGAAAAGCCA
TATGTGGAACTGAAGGACAGTGATGGCCGACCAGACTGGGAAGTAGCTGCAGAG
gtttgtcagttttgagtttctaatgtaagcaatagacaaaatgttctgaccacaaataca
tgtagcacaacttaaatgcaaactaaactattctgagatcagaattttactgcaaaaatt
aaggaatttctatttctatgcttaattgttatgtgataatgccaaaacaaaaataccttt

 1.19 Intr +  18274  18388  115  0  1   46   96    -6 0.434  -3.98
agagtaaggattatattctttacttttaaatccaatatatttaaccagtttctgtgaatt
tatatagaaatgcctctcttttggattttgagagaaaattctcatcttttttattgctag
gcctgggacaaccatctaagaagaaatagatcaattattgtggatttgttccatgggcag
CTAAGATCTCAAGTCAAATGCAAGACATGTGGGCATATAAGTGTCCGATTTGACCCTTTC
AATTTTTTGTCTTTGCCACTACCAATGGACAGTTACATGGACTTAGAAATAACAG
gtaggtcacaaagttctgaaaaattacttgattccattaaatttactttatttaaatagc
ctgaatttgtaagcatagttatttgtttacaaataaagactggtagtcagcatattataa
tcgagcaacctaattttaggcatgacttgaggtttgaaagatgtagattggggcatgttt

 1.20 Intr +  18832  18983  152  2  2   84   90    80 0.887   7.68
tactgatttcacttaatattatccctaagtaccatctgttttagtgtttacccataaaat
aaaaattctaggctgaaatatttgctattatatttacaggtcagatatatctgtacacag
catttaaggctttcaatgaaacctgcattttactgataaaagatcttttctctttactag
TGATTAAGTTAGATGGTACTACCCCTGTACGGTATGGACTAAGACTGAATATGGATGAAA
AGTACACAGGTTTAAAAAAACAGCTGAGGGATCTCTGTGGACTTAATTCAGAACAAATCC
TACTAGCAGAAGTACATGATTCCAACATAAAG
gtaatgttaactactctaagaaacttttgattctatccttcaaagatgacatttttctca
attatgatgatcagttgttaggttatgtgaccaagagagatactaaaacataacgaaaac
tgaacaacaacaaaaaatgccaagttttccaacccagaaacttaaaagagttttctacca

 1.21 Intr +  19892  20003  112  1  1   95   82    28 0.950   2.85
ttagttttcagttatttttatcaagcattcatcctttatgtagttgaaaaattattcaat
catctcgttggttttatggatgaaaggacctaagacattcttttgaaatacattagagag
agaacttttcctttttatctgaaacatctcccccttctcatcttgctgctgtttctgtag
AACTTTCCTCAGGATAACCAAAAAGTACAACTCTCAGTGAGCGGATTTTTGTGTGCATTT
GAAATTCCTGTCCCTTCATCTCCAATTTCAGCTTCTAGTCCAACACAAATAG
gtaagatagaactagaactccttctcatgactgcacctttaaatatttgtctaagagttg
tcatcttttttatatttgttcatgctgaggatgttatagcagaagaactttggaactcaa
gggaaaccttactgattattccatattttttcgatgagaaacctaaaatttagagaaccc

 1.22 Intr +  21365  21576  212  0  2   59   49   149 0.432   6.73
gttagggaagtaaaactggaaattaaaatcttccaataaatctagaattatttatactat
gatttctccctgccctgtgttaagagactacactgtctctcgtcctcaggatacttgaga
aaagagcaaagatgaaaataccacaagcttatgatgctgtacttatctttgaatttgtag
ATTTCTCCTCTTCACCATCTACAAATGGAATGTTCACCCTAACTACCAATGGGGACCTAC
CCAAACCAATATTCATCCCCAATGGAATGCCAAACACTGTTGTGCCATGTGGAACTGAGA
AGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCTCTTCCTGACAGCCCCTTTA
CAGGTTACATCATTGCAGTCCACCGAAAAATG
gttagttaaatgttaggcaactcactgccagtcttgctagtgtcatttgtgaaatagcca
ttttctgtctttgcaacatcattgaatgcattttcttctcttttttctttaatttttaaa
aatttaatacttttacaaattttatttttttacttttctatcctgtcctcaaaacctgtt

 1.23 Intr +  28231  28415  185  0  2   88  109    11 0.584   1.79
tgactccactgtaaaccgttctctttgtgtcaataaagatggttttataaacatagagaa
gaatgtgatagtgactaatttgaaatggtgataatgcctatcattggcagagttagaaga
actaaagggaggaatcagaggcctgtcttctcaactctctattctcgtttgtacatacag
ATGAGGACAGAACTGTATTTCCTGTCACCTCAGGAGAATCGCCCCAGCCTCTTTGGAATG
CCATTGATTGTTCCATGCACTGTGCATACCCGGAAGAAAGACCTATATGATGCGGTTTGG
ATTCAAGTATCCTGGTTAGCAAGACCACTCCCACCTCAGGAAGCTAGTATTCATGCCCAG
GATCG
gtgagttcaggggatccatctaaacctgtggtttccaaactctagaaaaataatttatat
gaattctacatgacagatagggcccagcccatgtcaagtttggcgcccagccaaaataag
ttatttaaataattatttaaagtatttattttaaataaatactttattttggaagaacca

 1.24 Intr +  34337  34423   87  2  0  109   71    23 0.770   1.79
agagtgtatttggtactgggctgcagctaatggattagggtaagtaacattgagctgtca
acatgagcatactgctgtggcaaatgccccttcctaggattacttcaagagaagatgaaa
aggagttggacctcgaaccagaaatgcttcttacactctttttgttctcttctgtttcag
TGATAACTGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAA
CTCCTGTGCTTGGTGCCCACAGTATAG
gtaaagtgacctgcaaaagaattactttagtagaatttcagctttagatattatacaatt
ttcctaagatttccaattttgagaagtaaatagtgaataatgagaaacttaagaactgtg
gctgggcaccatggctcaggcctgtaatcccatcactttgagaagccgaggcgggtggat

 1.25 Intr +  35693  35813  121  2  1   98   90    58 0.984   7.50
atgataataattattaataagtatccttacatttatcagagtctgaagttagaagcccat
gacaaattgtgaggcccaagaggaaagcagaaaagtaggaagggagaatattttttatta
agaaaatttaaattccttcataattatttcttcctctgtggatctttcccccctttttag
ATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGACAGAGCTTTCATTGGAAATGCCTA
TATTGCTGTGGATTGGCACCCCACAGCCCTTCACCTTCGCTATCAAACATCCCAGGAAAG
G
gtaagaatttagggccaccgtaaaatggtggtttttatatgggaaatttcccccagtgta
actattatgccatttctgtttgacaatttaaaaacaaccagaaaaaccttcattggcatc
ctctatggcacctaatatattgacatgtttgcttgagctttttcattttccagcttctgg

 1.26 Intr +  40741  40932  192  0  0  110   84   179 0.999  19.39
cctcggcctcctaaagtgctaggattacaggcctgagccatcatacccagccagttgtat
tttctttttccttataaagagtaaaataagggtgagtgaccgagcggttgatgcatagct
agatcaccagtttaaatgccttcccacacacccctttcctcctgttccctctacctacag
GTTGTAGATAAGCATGAGAGTGTGGAGCAGAGTCGGCGAGCGCAAGCCGAGCCCATCAAC
CTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAAGAGCTAGGGGAAAGTGAGATGTAC
TACTGTTCCAAGTGTAAGACCCACTGCTTAGCAACAAAGAAGCTGGATCTCTGGAGGCTT
CCACCCTTCCTG
gtatgttacggtcctgcctctgagagagcaggaatctagcataaaagaaagaagacatga
acaaacaggaggttttgttatttttgagaataagacttttcctgcagcagtgtttaaaac
acattctgtacaaggtttttatgttgaatacagagatgaatctttctacaaatatttggt

 1.27 Intr +  41576  41864  289  1  1   98  100    94 0.634   8.42
actagggcctgtgtagaggcctttatgaaaccatatttttgaagtctttaaaaaataatg
aagagtaaatgttctgttatatatttccaaacattcacatgtatttgacttgttttttcc
atgtaaattttgtatcttcagaaccctttaatgcgatgttttctacctttacttctccag
ATTATTCACCTTAAGCGATTTCAATTTGTAAATGATCAGTGGATAAAATCACAGAAAATT
GTCAGATTTCTTCGGGAAAGTTTTGATCCGAGTGCTTTTTTGGTACCACGAGACCCGGCC
CTCTGCCAGCATAAACCACTCACACCCCAGGGGGATGAGCTCTCCAAGCCCAGGATTCTG
GCAAGAGAGGTGAAGAAAGTGGATGCGCAGAGTTCGGCTGGAAAAGAGGACATGCTCCTA
AGCAAAAGCCCATCCTCACTCAGCGCTAACATCAGCAGCAGCCCAAAAG
gtgaggcctgggggccttatgcagttgctttcttgggactcctgtaggctacatatgttt
ctctgtcttctgttctggaacatcaggttggttgggtggaaggaacctatctggaatcag
acctatctgtatttgagctatgtaagttgtagcaagagattcagcctccctgaatctatt

 1.28 Intr +  43288  43724  437  2  2  105   89   401 0.999  35.20
gaagaagacaaaaatgtaacttactggctacacaataggaaccaaagggtagccagtcat
gactcccctgtctttacctttgtgtgtacagttgcaaagctaacctcggagttagcattt
ggggctggcttactttctggcatttggatttgtgaatcttttcttctgtcctgttcacag
GTTCTCCTTCTTCATCAAGAAAAAGTGGAACCAGCTGTCCCTCCAGCAAAAACAGCAGCC
CTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAAGGGAGGCTCCGGCTGCCCCAGATTG
GCAGCAAAAATAAGCCGTCAAGTAGTAAGAAGAACTTGGATGCCAGCAAAGAGAATGGGG
CTGGGCAGATCTGTGAGCTGGCTGACGCCTTGAGCCGAGGGCATATGCGGGGGGGCAGCC
AACCAGAGCTGGTCACTCCTCAGGACCATGAGGTAGCTTTGGCCAATGGATTCCTTTATG
AGCATGAAGCATGTGGCAATGGCTGTGGCGATGGCTACAGCAATGGTCAGCTTGGAAACC
ACAGTGAAGAAGACAGCACTGATGACCAAAGAGAAGACACTCATATTAAGCCTATTTATA
ATCTATATGCAATTTCA
gtaagtggtttattatacggttttcagagagtggtctgtgttttgttcacttgtcttcat
gtattcatcagcaagtatttttcaggtcctgctaatttcctagcattgagcttagtgata
gacaaagttaacattgaaatctgggctcacagatgtggtgtggtggctcacacctgtaat

 1.29 Intr +  44396  44488   93  1  0  109   82    80 0.999   9.66
cttatgacttttgtattttgctttttgcttattttggttttagagaaagagggttctaaa
atattttctcacctattgatcatttacatgatcagtgttctcctgctcagatcttagtgc
tataccctggccatagtacagttaactactaacatacctccactctcttatctcttacag
TGCCATTCAGGAATTCTGAGTGGGGGCCATTACATCACTTATGCCAAAAACCCAAACTGC
AAGTGGTACTGTTATAATGACAGCAGCTGTGAG
gtaaacattctcaatctttgaatgaaagttagaatatcaacagaactggggaacatttgt
tgaaataatggactatctcttgaataggaaatagatatttctgttagaattaatatatag
atgctgtcagtattaaaggaacaaaagtgatatgcagagcagggaatgaaaacatgagta

 1.30 Term +  45614  45787  174  1  0  105   42   208 0.986  15.66
agcaaacattggaaataatggggctcattttaaaggggcaggtgtgagacagccaaacta
gtgagcttattggaagcaatcaggttagtaattacagagggttggtcttccctttcctgg
caaggatttagagtcataatagtgatggctttttgttaaaggtttttcttgccctttcag
GAACTTCACCCTGATGAAATTGACACCGACTCTGCCTACATTCTTTTCTATGAGCAGCAG
GGGATAGACTACGCACAATTTCTGCCAAAGATTGATGGCAAAAAGATGGCAGACACAAGC
AGTACGGATGAAGACTCTGAGTCTGATTACGAAAAGTACTCTATGTTACAGTAA
agctaccactctggctgctagacagcttggtggcgagggagatgactccttgtagctgat
acttggcaaaagtgtcactgaaagacaagctaaatgtagttattttatcctgttagaaca
aaaattctaattaaaatagttaacttgaagagtagaaacaattgtattttgaagtctcat

 2.02 PlyA -  47484  47479    6                               1.05
 2.01 Term -  48679  48549  131  2  2   70   43    98 0.722   1.84

Predicted peptide sequence(s):


>USP6_1|GENSCAN_predicted_peptide_1|1512_aa
XQGPIVMRAMTSECHWCLAPIRSPDCVCVLRQLHTRSGIHKRFCGLKGFLPERHNPGQLI
HQNQSGCCSRMYPFDRKLGISVALNIPGGRSYRDLWCLTAVHIHIPGIDHHRLFTLGRMD
MVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAR
EAKLIDRVYKGIPMNIRGPVWSVLLNIQEIKLKNPGRYQIMKERGKRSSEHIHHIDLDVR
TTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSHITALFLLYLPEEDAFWAL
VQLLASERHSLPAAWAPAALGAHKWADQAQVAASHHPVSPGPTPLPGDDQEAQHPPCSGR
SVVASKSGLPFCTLAQEASRGTSSQAPGDVPVPPPQGKGRMISLGLTLRLWDVYLVEGEQ
VLMPITSIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLTRKQG
DLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTP
CPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFE
WSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGL
SNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWS
GTQKSVAPLKLRRTIAKYAPKFDGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSD
GRPDWEVAAELRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLEITVIKLDGTTPVRY
GLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDSNIKNFPQDNQKVQLSVSGFLCAFE
IPVPSSPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGMPNTVVPCGTEKNFT
NGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFGMPLIVPCTVHTRKK
DLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQKDGNSCAWCPQYRFC
RGCKIDCGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESVEQSRRAQAEPINLD
SCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQFVNDQWIKSQ
KIVRFLRESFDPSAFLVPRDPALCQHKPLTPQGDELSKPRILAREVKKVDAQSSAGKEDM
LLSKSPSSLSANISSSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGS
KNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQDHEVALANGFLYEH
EACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAK
NPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSTDED
SESDYEKYSMLQ

>USP6_1|GENSCAN_predicted_peptide_2|43_aa
XEQIEAEGEGPTAVTFISSQHCQMSPWISQTDNKGHLWFLGAR