GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:43:45

Sequence SMARCE1_1 : 21682 bp : 37.56% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1994   2077   84  1  0   64   56    85 0.095   2.50
gtgttaagcgaaatagtgtcataagcgtaccccgtataaagtatttcttgaacaaatatt
tatcgggtatttatttttatgccaggcaccaaagatggatccaacggtggacaaatgtac
aagcccactcttaaattttgtattctagcaaaagagagcaataattttaaagtattaaca
ATGAAGTATAACGTACAGGGAGCTTATGTTAGTTGTCAGGGTCCCCTGCAGCGAGGCCTG
CTGGATGTTGACAGCTCCCTTAAT
gtgagcagaaaggaaatctacaccagagtcaaaggtttctggctgttctttaagagggaa
agactcaggttggaccattgagaaaatgagctgtttctttccacaccaggactcattcct
tatgctccagggaatttccttaaaattaataatagaagcgaaaaatcagatctattccac

 1.02 Intr +  11477  11557   81  1  0   75  100    75 0.980   6.32
atgtgcttaaagtcattttcttttgaacatttctgaatttgcagtgatagctattttcag
tgaagaaaatatttggacgaatagaagaaaggcgcattagaattttttaagggactctct
tttcagtttgccagtgaactccttacagttgaataatgaatgtatttaactctttcgtag
GCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTGATGCCC
TACATGAGGTACAGCAGAAAG
gtaggtgcttaggacctggtaaggagtgaggacactgtctttgctgcttctttgcttaac
atccaactttagatcggcttagccagcttttctgtgcatattcagaggaaaggtccaaaa
aaatacggtttttaaagcaattagttctgatttcaaaattccagaactaaaatccaacaa

 1.03 Intr +  12523  12654  132  0  0   99   97   151 0.999  17.02
gcaaagataacttgagattggccagttcttgataatttttgaagtaggctgatgagtacc
tagaaatttgatactgttttctctgctttgtatgttgaaaagtttccacattaaaaacta
tttttaaaggtctatacgtttagacatcagtattaacatttcatctgttttctttttaag
GTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATT
ATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATAC
GAAGCAGAAAAG
gtagggtaggggctcacagtgggatagataatgtgtaaagtacataaaacattggcttac
tatttataaaagtaacataagatttggtcagaacactgatgcagtactgaggctctgtct
acctgagtcaagtcagtttctcaaggcctcagatttcttgcctgtaaaaaggagataatt

 1.04 Intr +  12947  13118  172  1  1   25   53   211 0.872   9.89
ctctgtctacctgagtcaagtcagtttctcaaggcctcagatttcttgcctgtaaaaagg
agataattatcccaacaccctgtttacatcatatcttttgatattcaagtgagataacat
aggtctgcattataacctgcaaaatgttaattataaaaccaaaaaacatttgaatttcag
ATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATA
AATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGC
ATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATG
gtaaaagaaaaaaagtggggttttgtttatgctttctctgtgagttaagatatgagaaat
ctcttaagtataagtttttatttcttatcctaaatggaaaagaaagtataatttaagtat
cgtcttagtattttggttatattgagtaagatttgtatgtgaatttcccacaagaaaaag

 1.05 Intr +  16682  16854  173  0  2   55  103   180 0.877  14.94
acattacgtcctctgtatggtttttatcaagtaactgccccagtgctcccatgacgctgg
gcaggtccacttgttaggccagtgagggccatagttcgttggtaattaagtgttaacatt
gttacactcctttttatggttactggtgacctgatttccagaacaatttgttcactccag
ATTATGATGATGGCTTTTCAATGAAGCATACAGCCACCGCCCGTTTCCAGAGAAACCACC
GCCTCATCAGTGAAATTCTTAGTGAGAGTGTGGTGCCAGACGTTCGGTCAGTTGTCACAA
CAGCTAGAATGCAGGTCCTCAAACGGCAGGTCCAGTCCTTAATGGTTCATCAG
gtaaagtcataaaacattcatttcaataagatgtgcctataccacaaatcccaggtgata
tgattcctacaccatgcctaaatctacctgttaaatatgtcaatctaacctgttcctgat
ttggagaagaggtttaaggaagtggacctttcccagatgtttaataagtttgtcattaaa

 1.06 Intr +  17356  17457  102  0  0   75   32   146 0.950   7.15
tctttaacatttacctattgatcataatcatttctttgtgctgcattttgtattttttaa
atcttagctagactcatgtgataaatgatctaaagttcaaaacattatttggtacactgt
ttgaaagtatggaccattaaaaaatgagacacaattatgaagcctgatcctgtcttgcag
CGAAAACTAGAAGCTGAACTTCTTCAAATAGAGGAACGACACCAGGAGAAGAAGAGGAAA
TTCCTGGAAAGCACAGATTCATTTAACAATGAACTTAAAAGG
gtatctgtttaatatgttaactatacttttatcactatacctgttactttatttttcctc
attcttttttccaaaatagtgtttttattgaatgttgttcactttgaaacagggctaact
ttattataaacctgtaggatcctttttttataagattgttcccattctctggcaaaattg

 1.07 Intr +  18125  18335  211  1  1   11   91   339 0.953  24.06
agacccaagagtttcagagaagacctagaaccacatttttttggcacacacacacacaca
tacaggtgtatagatatatatatatagtttataggcaagaaaaccaacttttgaaagaat
atatctggctcaaaaattataaggaaaaaacattacggagttctgtttttttctgattag
TTGTGCGGTCTGAAAGTAGAAGTGGATATGGAGAAAATTGCAGCTGAGATTGCACAGGCA
GAGGAACAGGCCCGCAAAAGGCAGGAGGAAAGGGAGAAGGAGGCCGCAGAGCAAGCTGAG
CGCAGTCAGAGCAGCATCGTTCCTGAGGAAGAACAAGCAGCTAACAAAGGCGAGGAGAAG
AAAGACGACGAGAACATTCCGATGGAGACAG
gtaacccactagcaacaaacgcagaggcagtgccaagactttgtacggctgtctttaatt
taggtttttctttctaagtgcaagtattctggtacctgccactgagggtgattcccagta
ctaaatttgacatgatattgacattcagtattttaacctttaaatgcttacattatttat

 1.08 Term +  19981  20264  284  2  2   27   42   335 0.936  17.40
agctaaattttcatcggaagtatttgatctgcatttatttaataaatttcattcatttac
agctaaaaagtagattttcatacccaaattgttccaacattcttaaaagttctttagtca
cactggttcatttcaggggtttaataaccacatgtggctagtggcttctatattggacag
CACAGCTGTATACTGTCAGCATAACTAGAGTAAAATTTCATCTTGGAACTGACAGTGACA
AATGTGTGATTACAGAGGAGACACACCTTGAAGAAACAACAGAGAGCCAACAGAATGGTG
AAGAAGGCACGTCTACTCCTGAGGACAAGGAGAGTGGGCAGGAGGGGGTCGACAGTATGG
CAGAGGAAGGAACCAGTGATAGTAACACTGGCTCGGAGAGCAACAGTGCAACAGTGGAGG
AGCCACCAACAGATCCCATACCAGAAGATGAGAAAAAAGAATAA
gtgttgccttgttttgtgtgttctaaatactttttttaatgaaaaaatgttttttggttt
taatggtgttacgtggtttgtgtattaattttttttcttgtccatatcacaccaccaaag
gcttttggaccatttagcatcatgagcctaatggctcagtcagtcacctttcttaagtgt

Predicted peptide sequence(s):


>SMARCE1_1|GENSCAN_predicted_peptide_1|412_aa
MKYNVQGAYVSCQGPLQRGLLDVDSSLNASSGITIPKPPKPPDKPLMPYMRYSRKVWDQV
KASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYIN
AKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLIS
EILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTD
SFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQ
AANKGEEKKDDENIPMETAQLYTVSITRVKFHLGTDSDKCVITEETHLEETTESQQNGEE
GTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE