GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:07:36

Sequence SHBG_1 : 5579 bp : 52.88% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1311  111  0  0   55   61   151 0.995   7.27
gggtgatagctgagtcttgtgactgggcccctgggcaggggtcaagggtcagtgcccctg
tttcctttaccccctcctccccgggcaacctttaaccctccaccgcccacacgcaaggct
gcctgcctctacacattctcccaagagttgtctgagccgccgagtggacagtggctgatt
ATGGAGAGCAGAGGCCCACTGGCTACCTCGCGCCTGCTGCTGTTGCTGCTGTTGCTACTA
CTGCGTCACACCCGCCAGGGATGGGCCCTGAGACCTGTTCTCCCCACCCAG
gtgcaggagcgggacagggcactcagctcatgcagtcttcccttctctcctctggccctg
tagcagggcctctccctctgtctgtctctgacatgtccctactcagctttgtttgttttc
tctttctgatagagtgcccacgaccctccggctgtccacctcagcaatggcccaggacaa

 1.02 Intr +   1444   1535   92  0  2   92   25   116 0.977   4.99
cgtcacacccgccagggatgggccctgagacctgttctccccacccaggtgcaggagcgg
gacagggcactcagctcatgcagtcttcccttctctcctctggccctgtagcagggcctc
tccctctgtctgtctctgacatgtccctactcagctttgtttgttttctctttctgatag
AGTGCCCACGACCCTCCGGCTGTCCACCTCAGCAATGGCCCAGGACAAGAGCCTATCGCT
GTCATGACCTTTGACCTCACCAAGATCACAAA
gtatggggttggcctagcccttgacccagtcccctggttctgccctctctccatcagctc
ttctcttttccctgtcttcctttccttatctgtgaacaccatctcccccaaacccacact
ggttctcaaaggacacatgacatacacaatctttccttctgtgtccttccagaacctcct

 1.03 Intr +   1708   1897  190  1  1  110  115    45 0.947   9.51
atcacaaagtatggggttggcctagcccttgacccagtcccctggttctgccctctctcc
atcagctcttctcttttccctgtcttcctttccttatctgtgaacaccatctcccccaaa
cccacactggttctcaaaggacacatgacatacacaatctttccttctgtgtccttccag
AACCTCCTCCTCCTTTGAGGTTCGAACCTGGGACCCAGAGGGAGTGATTTTTTATGGGGA
TACCAACCCTAAGGATGACTGGTTTATGCTGGGACTTCGAGACGGCAGGCCTGAGATCCA
ACTGCACAATCACTGGGCCCAGCTTACGGTGGGTGCTGGACCACGGCTGGATGATGGGAG
ATGGCACCAG
gtaagctagctctggtcctcaggggagggatgtctggagctggtctgaggaaagggaaca
aaaccaagttattgggcatccctctaccactgtcatctcgtttaatccacacgaaccccc
acaaagtagctattcttggccccatcttttctgatgggaattctaaggctcagtcagtat

 1.04 Intr +   2228   2389  162  1  0  117   50   104 0.570  10.19
ctgatgggaattctaaggctcagtcagtatataagtgacaagagctgagtgacccaaggc
caaggatgctagctgcttctttaaggcatgttctttccactatagtactaggctgcctca
caggaaggtggcagaaacagatcccaggggcctctgattttgcttcccaccttcctgcag
GTGGAAGTCAAGATGGAGGGGGACTCTGTGCTGCTGGAGGTGGATGGGGAGGAGGTGCTG
CGCCTGAGACAGGTCTCTGGGCCCCTGACCAGCAAACGCCATCCCATCATGAGGATTGCG
CTTGGGGGGCTGCTCTTCCCCGCTTCCAACCTTCGGTTGCCG
gtaactacaccccaggggtggaaccctagccaagacttggtaaagcactgctgggtggct
ggccgtgggaatctaagtccacacttttagggagaagggaagggttgagagctgcaaggg
ggaggccaaatgctcagaggggagtcaactgagggcagggaggtcgggactgcggctccg

 1.05 Intr +   2617   2776  160  0  1   53   61    47 0.118  -1.43
ctgctgggtggctggccgtgggaatctaagtccacacttttagggagaagggaagggttg
agagctgcaagggggaggccaaatgctcagaggggagtcaactgagggcagggaggtcgg
gactgcggctccgatgccctgatttctacatccccgtatcttatctctgtcacactccag
CTGGTTCCTGCCCTGGATGGCTGCCTGCGCCGGGATTCCTGGCTGGACAAACAGGCCGAG
ATCTCAGCATCTGCCCCCACTAGCCTCAGAAGCTGTGATGTAGAATCAAATCCCGGGATA
TTTCTCCCTCCAGGGACTCAGGCAGAATTCAATCTCCGAG
gtagatttcctcggagtctatttttcccaccctggccagctcagcctgcctctgtccccc
tctaccactggcccctttcctccttgagaccccagctttgaggcctcaggataatcattt
ctccccacagacattccccagcctcatgcagagccctgggccttctctttggacctggga

 1.06 Term +   4232   4380  149  0  2  114   42    53 0.963   1.68
attttgaggggaaggaaacctctgggagggaagaagaataggccacaagaagaagatatg
ggggcagtggaaggtagtgcttttgcaaactcaggttggaggagtggaaaagtggggaga
agattctggatccgagccaccttaatgctctaatgccacctttgcactacctccctctag
GAGAAGACTCTTCCACCTCTTTTTGCCTGAATGGCCTTTGGGCACAAGGTCAGAGGCTGG
ATGTGGACCAGGCCCTGAACAGAAGCCATGAGATCTGGACTCACAGCTGCCCCCAGAGCC
CAGGCAATGGCACTGACGCTTCCCATTAA
agctccacctaagaaccccctttgaaagttactgattattcatttattcaacaaatattc
actgtgcactagcaatgtaccaggcactgtgccaagtattgagttgtcttaatgagcaaa
aacactctggttcctaccctcttggtgcccacagtcccatagggaagcagacatccatca

Predicted peptide sequence(s):


>SHBG_1|GENSCAN_predicted_peptide_1|287_aa
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGE
DSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH