GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:42:50

Sequence RARA_1 : 28924 bp : 57.77% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1302   1479  178  2  1   67  100   105 0.549   9.17
ggctccaggagactgagattagcctgccctctttggacagcagctccaggacagggcggg
tgggctgaccacccaaaccccatctgggcccaggccccatgccccgaggaggggtggtct
gaagcccaccagagccccctgccagactgtctgcctcccttctgactgtggccgcttggc
ATGGCCAGCAACAGCAGCTCCTGCCCGACACCTGGGGGCGGGCACCTCAATGGGTACCCG
GTGCCTCCCTACGCCTTCTTCTTCCCCCCTATGCTGGGTGGACTCTCCCCGCCAGGCGCT
CTGACCACTCTCCAGCACCAGCTTCCAGTTAGTGGATATAGCACACCATCCCCAGCCA
gtaagtctgggtgtgggggctggggtgggaagggactgtggagggtggcaggcctcagag
cttgggctctgggcacgtctgttctgctgtgagtggaaggcacggtgagcgacaaggtct
tctccagttggggtgaccatcatttgaggtcttaaaaatgaaagccctatggcctatagg

 1.02 Intr +  18399  18547  149  1  2  124  113   121 0.919  19.34
tcattggcagcctcctgccctgagtctggctggggagtcccagttttcttaagacttgaa
tcctgccagcagtggtgaggctgggagaggctcttaggagggacggtgaggcagggtgga
gcttggtactaaggatggcgacctaggtctctaactgcccctcccctcttctctctctag
CCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCTCGCCACCCC
CTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCCTCAGGCTACCACT
ATGGGGTCAGCGCCTGTGAGGGCTGCAAG
gtgagttgaaggggtcattgggaaggacagcttgatgaggtcaatgggatgtccccactt
ctgtgtcctgggagtgtgcagttggggggtgtccctgaagttgctgctcttctttctctg
tggaagttggcagcaagcagggacacctaccacagtttccccacaggtcctcccccataa

 1.03 Intr +  19867  20008  142  0  1  114   65   304 0.993  31.81
tgaggaggatccttttaggtgaatcattctccccagcttttctggcctgctcaggtaggc
gatgggcaaacgcttgggggcagcagctggcctggccctcctcccctagactgagaccgt
agccaggcactgctcccactgtgggtgtggacaacctgactccctcccctccatacccag
GGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTACACGTGTCACCGGGACAAGAAC
TGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTT
GAAGTGGGCATGTCCAAGGAGT
gtgagtgccatagggcaggggccgagtcccgcctcagttggggtctcagatgctcctaaa
gaccaagggagcagggctctgtggatgtttgtgcacatgcatgaacacgcatgccgtggt
gtgcgggctcacggttgaggatggtttgtgtgtagctgcaaggacctgtttgcgagtctg

 1.04 Intr +  21993  22153  161  1  2  124   68   280 0.948  30.50
gtgggcatggagggctggagtgcgtggcaatgccttgcctgcccgtgaacgcgtgctgtg
tgcgcgtgcttacaagcctgggtgacctcctcagcagctggcagctctctgtcaggctgg
gggtggacgaggccctgagcagcctgcagctgccctcttaaccccctctgccctccacag
CTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGA
GCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGG
AAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACG
gtatggctttcccccggcctgcagggtgggatttgcccagggccacagggccaggatggg
cccctctcaggcaccccttcttgtgccaggcaagatctctgcgtccttcccttcccctct
cttctccctcctcctgctgcctcttcccaaggagctcccaggaagtgaaggctgggtaga

 1.05 Intr +  22414  22590  177  0  0   74   81   333 0.967  32.52
ttgtgccaggcaagatctctgcgtccttcccttcccctctcttctccctcctcctgctgc
ctcttcccaaggagctcccaggaagtgaaggctgggtagagggcaggcctgtgggggctg
gagccaggctgagaaggggtgccatggagaagaaggccctcactctccctcctcccccag
AACAACAGCTCAGAACAACGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAA
CTCTCCACCAAGTGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACC
ACCCTCACCATCGCCGACCAGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTG
gtgagggtctgcaccctggcccccaggcactgcccctgtgtcctgggtagatgtccttcc
agccagacagccaccctcctaaatgtctgtctgcaatcaacctgtccaaatgcccaccgc
ccaaatgtctgcccttcctctccccatatgtccacctgtccactcgtctccctgtccact

 1.06 Intr +  24385  24589  205  0  1   71   64   493 0.765  45.19
gctgaggtatggatggtgcagacgtagaacctttccatcattgtagaaaattctatcaga
cagcattgctccggccacctgccaggtggtcctccgggagtgctggtgcggagtgctggt
gccgagtgctcagagtgggttcgggttcagtccctgaacccaagcatcctctgcacccag
ATCCTGCGGATCTGCACGCGGTACACGCCCGAGCAGGACACCATGACCTTCTCGGACGGG
CTGACCCTGAACCGGACCCAGATGCACAACGCTGGCTTCGGCCCCCTCACCGACCTGGTC
TTTGCCTTCGCCAACCAGCTGCTGCCCCTGGAGATGGATGATGCGGAGACGGGGCTGCTC
AGCGCCATCTGCCTCATCTGCGGAG
gtgggcagggggcctgggtctgggggctgggctgggacgggggtgcagccctggagtctc
ttccagggagctctttcaggccacctctgttaggtatctctagagggcagggtctggtct
gcaactacacagcaagggggccatgtggggcctggactcctgttcccgatttctgggcaa

 1.07 Intr +  25346  25504  159  0  0   79   72   303 0.988  28.95
gttgctcccttttaagggcctctgtaccctgcggcagcagagaccccatgccctgccctg
tgtggggaggcgcctgcgagctgccctcctccatggcctgggcaggcacgccccccggtg
gccgaggctgggggtgcagctgtgttcccagctgctcagggggtggttctgcttcctcag
ACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGG
CGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGC
TAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGG
gtgaggctcacagacctggaggggtaccggcccccgacacctggcccaggcccccacatc
caagccagcaccccatgtctttgtgccaggacaatacgacacctgtccccatctgtgtct
aggctgaggtcccctagtgactccactttgccgaggtggcccgcctgtgtcacctttgtg

 1.08 Intr +  26092  26205  114  2  0  147   23   167 0.565  17.69
cattgccaccagcctctggacctgggggcttaagagagctggctcgtgtcaaagaactga
atcccaagaaagatgctaatatcagcagtattgatcttcccacctcgagccaggcttgct
ggggctgggggtgggagggctggcccagcgtgctgacctctgccccctcctttcctgcag
GGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCC
AGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGG
gtggggggcgggacgggggtggcctggcccccccgccaggcagctgtagccccagcctca
gccccagctccaacagaagcagcccggccacccactccccgtgaccgcccacgccacatg
gacacagccctcgccctccgccccggcttttctctgcctttctaccgaccatgtgacccc

Predicted peptide sequence(s):


>RARA_1|GENSCAN_predicted_peptide_1|429_aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGX