GENSCAN 1.0	Date run: 15-Jan-104	Time: 16:04:47

Sequence PSMD11_1 : 38939 bp : 43.19% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1241   1331   91  1  1   89   28   103 0.639   5.32
tgcgaggcggtcccgctctccccacccctcagcccgcgcccggcggagagactacaactc
ccggagtgctctgggaacggagccacgggagctacaggcggagggacccgagggcgggct
ttccgggtgtgtgtttccggcgtcggcggccgcggccggggacggtgtgagagcggtaag
ATGGCGGCGGCGGCGGTGGTGGAGTTCCAGAGAGCCCAGTCTCTACTCAGCACCGACCGG
GAGGCCTCCATCGACATCCTCCACTCCATCG
gtaaaggtcgccgcgccgcctccccggccccgccggcccagctcggcttatgtcggtcgg
cggcagcggagaggggcccggctagccggctctgatgctgctgactcactgtgtgagggg
ggccgggccgggggcgcaggccgctcggagctccccagagcctcccaggtctcactcttg

 1.02 Intr +   3662   3763  102  0  0   52  111    95 0.993   8.35
ttctacgtatatatgatcttttttttttcctggcttagagttttttttttttttttaact
ctagaatttgtcttttggtaaatatgtttgagtttgtaatggatcttatgagggtgaaat
ttccctcagtcttcattttttggtcagaattttaagagggtttgcattttcctctcccag
TGAAGCGTGACATTCAGGAAAACGATGAAGAGGCAGTGCAAGTCAAAGAGCAGAGCATCC
TGGAACTGGGATCTCTCCTGGCAAAGACTGGACAAGCTGCAG
gtaagtgctacacatggattgtatctgaaatgctcagtgaaattcctgtcttttgttgga
gtgaagaatcatgggactgatccacaaactgaattcagctttattttcttggcaacttgt
tgagcttcagttttttagcaggcaattaagtggcctttaaactcacttctttcctggtag

 1.03 Intr +  11212  11336  125  2  2   95  107    73 0.998  10.20
ttaacttatttttgctattctgctatttgctaggaatgctttaaactcctagtaagtttc
acttagactgattccagtgatgtaagtaccgatttttatgacgttgggtcagtttcttaa
gtgggtattttgtctcaaatgttgatgtttactcctctttttgaattgcctttcctacag
AGCTTGGAGGACTCCTGAAGTATGTACGACCCTTCTTGAATTCCATCAGCAAGGCTAAAG
CAGCTCGCCTGGTCCGATCTCTTCTTGATCTGTTTCTTGATATGGAAGCAGCTACAGGGC
AGGAG
gtaagtgatattaatgacagaaagtagacaatatggagaaaagtttgtttccaagaaaga
aatgcctacctgcactttagtactaatgtggaagggaaaactgggaggacagcgcaggac
ttatcatgtcagtttctctttgttacagggcatttgatactttgggtctgttccatgctt

 1.04 Intr +  20766  20837   72  2  0  113   92    17 0.938   4.20
aaagccaagttgatgctccattatgatataactattacacattgagatactgtggatcag
acactaaatagagcaacatggataatatgtaaggagggaatttaagctgttctccaaagc
atggtttgtgggaagaatttgaggacataatgttgcatgtactgtctctccttattgcag
GTCGAGCTGTGTTTAGAGTGCATCGAATGGGCCAAGTCAGAGAAAAGAACTTTCTTACGC
CAAGCTTTGGAG
gtaggttttacattagtactcatttcaggtctctaagcatgagacagagggtgaatgtaa
gcagtaccatccttatcaaaagtatcttcagcaactttgtaattacctagataccgaaag
attattgatggtagccccacttatgataattgctctgattgaagttttgagacagatttg

 1.05 Intr +  21238  21295   58  0  1  129  106    36 0.995   7.96
aacagtcatttgctggctataataggagacaatacattggctagatcgtctcttatgctg
aatttgatgctatcatcagaaattgcatatttaacagtaacagttctgtgactgtcaatc
tttgatttctttctgtggctttttccccccccttcaatcaatgccttttctctttcctag
GCAAGACTGGTGTCTTTGTACTTTGATACCAAGAGGTACCAGGAAGCATTGCATTTGG
gtaagtaagctggtaataagtcatctcagctagctaaatgaatgtattctaaaccacctg
gctactcttactaattacctgttaataatttatattctactgacttctaagaaggattta
aagtagcttacagttctgcatttgtcatgggaaaatgtcatttgaaagtttaaaaaacta

 1.06 Intr +  25716  25910  195  1  0   92   59   253 0.911  22.19
ctcttggaagatagcacattagtggaaaatttaattattgcatggggtctagaggtaacc
ttttttgagttcaggaatttttttttttttttaatcctgagtgttatgagggtgggagag
tgagctattattaggtattaagctgatggctataaaggagaatgtcttttcctttttcag
GTTCTCAGCTGCTGCGGGAGTTGAAAAAGATGGACGACAAAGCTCTTTTGGTGGAAGTAC
AGCTTTTAGAAAGCAAAACATACCATGCCCTGAGCAACCTGCCGAAAGCCCGAGCTGCCT
TAACTTCTGCTCGAACCACAGCAAATGCCATCTACTGCCCCCCTAAATTGCAGGCCACCT
TGGACATGCAGTCGG
gtaacagacgtagctattcctgggatgtgttttcttaaagctcatcttattttataggtg
gaaggaatgggggttggggctggagaataaaattggctgatttggctctagcttcttcag
agaaccagttagaaagctacctttctaactagctgctcccctcctgttaactgcctaaaa

 1.07 Intr +  30518  30662  145  0  1   78   63   228 0.986  18.64
ctcaggcttgtctcgaactcctgggctcacatgatcctcccatctcagcctcccaaagtg
tggatttacaggtgtgagccaccgtgcccatttaggtagatgtctaagctgcctcccagc
tctgatcttttatggctctattattttatatgttcttattcctttcttttcaatgcccag
GTATTATCCATGCAGCAGAAGAGAAGGACTGGAAAACTGCGTACTCATACTTCTATGAGG
CATTTGAGGGTTATGACTCCATCGACAGCCCCAAGGCCATCACATCTCTGAAGTACATGT
TGCTGTGCAAAATCATGCTCAACAC
gtaggtgcaccttaactctggactacaagaactcagatccttcagcaagtctgtttgcca
tggcagagatggcctgagcagggagtttggccagttacagaaacagcagcagctgcggcc
tctagggctggctaaggtagagcgggaggatcaaaagtggtccagaaaactttcgcttgc

 1.08 Intr +  31481  31541   61  2  1   84   91    28 0.516   1.44
cagagtggagaaaacctagcttttgcaatgtgatgggcatatgggtttaggggttgggct
gattgtctgtgtgggcagagtctttattacaatggaattctgttaaaaagaaatttgccc
aaaccttcctttagaagcataacatctgcagcaattgaccaagtatgtctttttttctag
CCCAGAAGATGTCCAGGCTTTGGTGAGCGGGAAGCTTGCACTTCGGTATGCAGGGAGGCA
G
gtagggactcccttgactgcagttctgctcactctgagaccagcatgttttcagagtcac
aacgtttgatgagaccagcactcttcagatcttcatactactctcttccttctgccccac
tcacttccttcccttaagcccattcagtgtgtttcccagactgttaaattcttggcctgg

 1.09 Intr +  34238  34300   63  1  0   85  113     2 0.711   1.31
ggcatatagtggtattcagtacttgcggctcttcttcccgggcgtctgaagaagaacgat
ggtggggcgggttcttccttttggcagaagttgtgtggacacagcatactgcttatgaga
cttgggtaaatgttagtgtgcagaataaatcgctttcatggtttgtctctttattctcag
ACAGAAGCATTAAAATGCGTGGCTCAGGCTAGCAAGAACAGATCACTGGCAGATTTTGAA
AAG
gtgagtatgatattgggttggtatggaatgtgagtggaagagagggacgtttaagtactt
caaaacacacttttaaaaataattatagtttcaaaagaagttgcaaatgattccatgtat
ccttcacctaggacagtattaaaaccaggaaatagttaagcactttgtacaatgaaactt

 1.10 Intr +  35968  36093  126  0  0   78   94   114 0.999  11.88
aacttccctttcagttcttgacattccttttctgctttgtatcatgcatctccccagatc
tcccctaacttcattcaaccatgtagttttataagggccagcagactatctaggaagcag
gagtagcatgactttaaagtgattctctgtgccaatctctgcaactggttcctttggcag
GCTCTGACAGATTACCGGGCAGAGCTCCGGGATGACCCAATCATCAGCACACACTTGGCC
AAGTTGTATGATAACTTACTAGAACAGAATCTGATCCGAGTCATTGAGCCTTTTTCCAGA
GTACAG
gtgagaaccctctggggactccatttctggccaggcattctcactgtagccacctccctt
ccacacctgtccagaatgggaactcacttctaggggtgtgcctggtgggcaagaggccac
caagagcttgggcctctgttgataaaatgaacaaaaatcgaggagagagatgctgtgggt

 1.11 Intr +  36863  36914   52  1  1   58  115    28 0.996   0.98
cattggaaagctccccagcttctcagtggggaatgggcagtgtggactagagtaggagtt
gcattgttgctattttgttttcagtccatttggcctaagacccctccaacaaagctactg
tgtcagggtgatctctgactagtggatactggtccctttaatcatgtgctttgattttag
GCCGACGTGGAAAGGAAATTATCACAGATGATTCTTGACAAGAAATTTCATG
gtaagtaacagtcacacaggcaagggggctggtggtggtgatgagatggttgaagaagtt
tattttcaaagaagatgttctatttgtttcccccgatggttcaccctggggtcctggccc
ctcttccctgtgatgagaatgtgtaataagcatgtgtacatggaatagggagatgaattc

 1.12 Term +  37206  37348  143  1  2  105   43   165 0.999  11.79
tcctggcccctcttccctgtgatgagaatgtgtaataagcatgtgtacatggaataggga
gatgaattctatttcccttcttttctggacacagtgagtcaactagggagtgggctgctt
cacaaacacttttgtgtctaacctcatcttttacctgggttgcccttgtgtttcttgcag
GGATTTTGGACCAGGGGGAGGGTGTCCTGATTATTTTCGATGAACCCCCAGTAGATAAAA
CTTACGAAGCTGCTCTGGAAACAATTCAGAACATGAGCAAAGTAGTGGATTCCCTCTACA
ACAAAGCCAAGAAACTGACATAG
gtgagtgctggcttcaggaccccagggctgggcagctctgtcttctgcgtgtcgagactg
aaaacctcctcctggtgtcctcatggcttcctgattgacactgctctgtcttctcttgca
gagttggatctgtagcggtcctttggagagtgtgtgtggcgggagagtgaaaccttgggg

Predicted peptide sequence(s):


>PSMD11_1|GENSCAN_predicted_peptide_1|410_aa
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQADVERKLSQMILDK
KFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT