GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:39:19

Sequence PNMT_1 : 4621 bp : 61.48% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1423   1624  202  0  1   89  105   369 0.951  35.90
tgtctgcagcccggacactaagggagatggatgaatgggtggggaggatgcggcgcacat
ggccccgggcggctcggcggtcagctgccgcccccacagcggaccggtcggggcgggggt
cgggcggtagaaaaaagggccgcgaggcgagcggggcactgggcggaccgcggcggcagc
ATGAGCGGCGCAGACCGTAGCCCCAATGCGGGCGCAGCCCCTGACTCGGCCCCGGGCCAG
GCGGCGGTGGCTTCGGCCTACCAGCGCTTCGAGCCGCGCGCCTACCTCCGCAACAACTAC
GCGCCCCCTCGCGGGGACCTGTGCAACCCGAACGGCGTCGGGCCGTGGAAGCTGCGCTGC
TTGGCGCAGACCTTCGCCACCG
gtgagcgggggaaactgaggcacgagggacaagaggtcgtcggggagtgaaagcaggcgc
agggaaataaaaagaaggaaagggagacagaccaggcgcctaacagatggggaccaagaa
acaagagatagctgagaggtgcaaacagaagagaaaaaagagcaacatcccttaggagag

 1.02 Intr +   2576   2783  208  0  1   97   74   355 0.999  34.35
ccatgttggagctgggttcagtctaactctggggccaatgctttttccagatggagacac
atttgcagaggagaaggaagaactagagagaggcagggagatgcaggggagggaagggta
aggaggcaggggctgcctgggctggctggcaccaggaccctcttcctctgccctgcccag
GTGAAGTGTCCGGACGCACCCTCATCGACATTGGTTCAGGCCCCACCGTGTACCAGCTGC
TCAGTGCCTGCAGCCACTTTGAGGACATCACCATGACAGATTTCCTGGAGGTCAACCGCC
AGGAGCTGGGGCGCTGGCTGCAGGAGGAGCCGGGGGCCTTCAACTGGAGCATGTACAGCC
AACATGCCTGCCTCATTGAGGGCAAGGG
gtaaggactggggggtgagggttggggaggaggcttcccatagagtggctggttggggca
acagaggcctgagcgtagaacagccttgagccctgccttgtgcctcctgcacagggaatg
ctggcaggataaggagcgccagctgcgagccagggtgaaacgggtcctgcccatcgacgt

 1.03 Term +   2898   3336  439  0  1   84   55   492 0.940  41.34
ggaggagccgggggccttcaactggagcatgtacagccaacatgcctgcctcattgaggg
caaggggtaaggactggggggtgagggttggggaggaggcttcccatagagtggctggtt
ggggcaacagaggcctgagcgtagaacagccttgagccctgccttgtgcctcctgcacag
GGAATGCTGGCAGGATAAGGAGCGCCAGCTGCGAGCCAGGGTGAAACGGGTCCTGCCCAT
CGACGTGCACCAGCCCCAGCCCCTGGGTGCTGGGAGCCCAGCTCCCCTGCCTGCTGACGC
CCTGGTCTCTGCCTTCTGCTTGGAGGCTGTGAGCCCAGATCTTGCCAGCTTTCAGCGGGC
CCTGGACCACATCACCACGCTGCTGAGGCCTGGGGGGCACCTCCTCCTCATCGGGGCCCT
GGAGGAGTCGTGGTACCTGGCTGGGGAGGCCAGGCTGACGGTGGTGCCAGTGTCTGAGGA
GGAGGTGAGGGAGGCCCTGGTGCGTAGTGGCTACAAGGTCCGGGACCTCCGCACCTATAT
CATGCCTGCCCACCTTCAGACAGGCGTAGATGATGTCAAGGGCGTCTTCTTCGCCTGGGC
TCAGAAGGTTGGGCTGTGA
gggctgtacctggtgccctgtggcccccacccacctggattccctgttctttgaagtggc
acctaataaagaaataataccctgccgctgcggtcagtgctgtgtgtggctctcctggga
agcagcaagggcccagagatctgagtgtccgggtaggggagacattcaccctaggctttt

Predicted peptide sequence(s):


>PNMT_1|GENSCAN_predicted_peptide_1|282_aa
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL