GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:00:00

Sequence NUP88_1 : 35976 bp : 42.76% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1227   1523  297  2  0  115   95   425 0.971  43.17
ccttggtgacgcccctgcttggtgggctggcctcgccttcgccccccgacctggcacgag
cctctcgagcttccgggccgtctgctcggtgattggccgaaacagtgagtggacggccgc
ggattggctgtgctcagcggcgggctgagcaactggagtgaggggagcagttgggccaag
ATGGCGGCCGCCGAGGGACCGGTGGGCGACGGCGAGCTGTGGCAGACCTGGCTTCCTAAC
CACGTCGTGTTCTTGCGGCTCCGGGAGGGACTGAAAAACCAGAGTCCAACCGAAGCTGAG
AAACCAGCTTCTTCGTCGTTGCCTTCGTCGCCGCCGCCGCAGTTGCTGACGAGAAACGTG
GTCTTTGGCCTCGGCGGAGAGCTTTTCCTGTGGGACGGAGAAGACAGCTCCTTCTTAGTC
GTTCGCCTTCGGGGCCCCAGCGGCGGCGGCGAAGAGCCCGCCCTGTCCCAGTACCAG
gtaatgccaggccgatcttggaagtgaccctcaccgggatcggaaccagtcttttttgtt
ccttgctcctcttggctgtttttcatcttgtggcaggcgttccagcggattgactccgac
gctgccatacgcggtcgcggggactcaggctctctcgatgcttacggcctggaggcctgg

 1.02 Intr +   4195   4364  170  0  2  100   97    18 0.824   1.72
aagactctgtctcaaaaaaaaaaaaaaaaatttgtgagttaatggtacaagtgtgagtac
ttatccagagttttattatcctataattgtagtaaactaagtattactgtgatttcaagt
aactgccacctatatttaaattaaaattaactatgttgactggtttgctctaattttcag
AGATTGCTTTGCATAAATCCACCCCTGTTTGAAATCTATCAAGTCTTGTTAAGCCCAACA
CAACATCATGTAGCACTTATAGGAATAAAAGGACTTATGGTATTAGAATTACCTAAAAGA
TGGGGGAAGAATTCTGAATTTGAAGGTGGAAAATCAACAGTGAATTGTAG
gtaagttgtatactatttatctgtataatttattatatatacagaaaattgttcaagact
agtggttcttaagcatgtttagtatactactcttaaaacattaaaacactcctcgtggtc
tgcagactggcttctgtgttatcaatgttcatagtatatgtgtaattgattgtactttat

 1.03 Intr +   6743   6868  126  2  0   23   99    78 0.663   1.27
ctgaggcaggagaatcacttgaacctgggaggcggaggttgcagtgagccgagattgtgc
cgttacactccagcctgggcaacaagagagaaactccatctgcaaaaaaaagaagttcct
ttagaagattttcatccaagttgtacaaaatgttttggaaaattattatctttattttag
TACCACTCCAGTTGCGGAGAGATTTTTCACCAGTTCCACCTCTCTGACTCTAAAGCATGC
TGCATGGTATCCAAGTGAAATCCTGGATCCCCACGTAGTGCTGTTAACATCAGACAACGT
AATCAG
gtaaattttatttctctctcttgaagccttgcgagtgggaaagctctgtttctgtttgcc
aattaacagctcaacatagaacgaagtgagtcattgaatgagtcagtgcttttattggat
ggctgttgtaacccattctcaatcataagaattgcctaactgctctaacttaccactatt

 1.04 Intr +  10088  10174   87  2  0   57  110    54 0.861   2.67
ccttatgtagttaaagaataaatgaactagactactttgcaacagcaagatttttgcaaa
gaaatagttgtgataagtgttagaaaattctcaagaactgactagatggagaggaaagtg
cagttttgggaaatgaaaacagaattttaagtgctggttttcttctcttttggttgctag
AATTTACTCACTACGTGAGCCGCAGACACCCACTAACGTGATAATACTTTCAGAAGCCGA
AGAGGAAAGTCTAGTACTCAATAAAGG
gtaagtttttatttgagtcttgaaatggttttttaattagcttattgggattataaatgc
aattttaacaggttgcaaggtttttcagaggtgactagcatgcttttggtaatgtgagaa
gtaagtgtatttttagtagaacagggattcgtcgtgttggccaggctggtctggaactcc

 1.05 Intr +  11968  12144  177  1  0   63  111   176 0.994  15.51
gaatttttaaatgttaacattcttcataatcattttttgtcttttcagtccattgcctac
aaattccatacatacccacctcctgttattagacattttgtgtttttgttttgttttgtt
tttctttttactttttgttgtttttgtttttaacaagttggtttttacatctctttccag
AAGGGCGTATACCGCATCTCTAGGAGAGACAGCAGTTGCATTTGACTTTGGGCCATTGGC
AGCAGTCCCAAAGACTCTATTTGGACAAAACGGCAAAGATGAAGTAGTGGCATACCCACT
GTACATCTTATATGAAAATGGAGAGACTTTCCTGACATACATCAGTCTGTTACACAG
gtaagttgaggtggtcacccacctgaaatgaaaactcagtttgggctccagtagatatca
ttgaggctggacttgggagccatgtttttgagtctgtggaaatgttgcagccttcacatg
cttggcttgcatatttttgagaaagagttagtacaggtcatttggcctttcatttcttca

 1.06 Intr +  15634  15820  187  1  1   71  127   183 0.999  19.27
ggttgagaaacacagagtggtgggatctgagtgggaaagcgagaagatggagtattggga
atacactacatttataatgaaggtatgatagctggaggaaaacaaagtcaaagaatggtt
ttatgggatgagcatgcatactgtcaacatttcccaaatatgtttttactccttctttag
CCCTGGAAATATTGGAAAGCTGTTGGGTCCATTGCCCATGCATCCTGCGGCTGAAGATAA
CTATGGTTATGATGCGTGTGCTGTACTCTGCTTACCCTGTGTCCCCAATATCTTAGTGAT
CGCTACTGAATCAGGAATGCTGTATCACTGTGTCGTGCTAGAAGGGGAAGAAGAAGATGA
CCACACG
gtaagtgcaggctgctgtggttgtttgtatcttcaacacctggcatagttcctgacccaa
tatgaatgcttaatatatgagaaggaattttaacttacttatggaacttctgatattttg
gaaattaaacagttaaaaaagtagctgaagcacacttagcagtctaagtggaaagaagtt

 1.07 Intr +  16631  16778  148  1  1   37   99    95 0.996   4.39
tggccaggctggtctcgaactcctgacctcagatgatccacctgcctcggcctcccaaag
tgctgggattacaggcaagaacagccgcacccggccctgacccagctttttgcctgtttt
taattgtgtacattttcaaattaacatgcaagatcaaaattacaacacttttttttacag
TCAGAAAAGTCCTGGGATTCCAGGATTGACCTCATTCCTTCTCTGTATGTGTTTGAATGT
GTTGAGTTGGAGCTTGCTTTGAAACTGGCATCTGGAGAGGATGACCCTTTTGATTCTGAC
TTTTCTTGTCCAGTCAAACTTCATAGAG
gtaagctcttcaataaatgtagtgcttttttcccatgatttttatactaagactatcata
gactgttcctatgtaatgtatttgttctgtggttccagcctttaaaaagttgactgggtt
ttttttagctttttagtcactatagtacactttttgtctaaggcagactgagcaaatttc

 1.08 Intr +  21227  21325   99  0  0   70  109    12 0.576   0.66
tatttgaaatttgaattcaaattttaaaatttcaaaacccctaacaatatgaaagtcttt
tataaaaccttccatcaacaaatgcgtttgtaggctaatgtggagtagccaacaaatttg
aggtaaatttttttagttatccactggctacctttgtatcattaatcattccatttgcag
ATCCCAAGTGTCCTTCAAGATATCACTGTACTCATGAAGCTGGTGTACATAGTGTTGGGC
TAACTTGGATTCATAAACTTCACAAATTTCTTGGATCAG
gtgagtttactaactctctgcacttttaatagatttcagaggaaaaatagatttaataga
tttcagaaaagtagtttggaatagaaaaatgatagagaaaatcagtgaaaccgaaaggtt
ctttgaaaagatcaaccacatttcacaagcctttagctagactaactataatcaagaata

 1.09 Intr +  23377  23499  123  2  0   58   90    37 0.330   0.54
catcacagacttagtggcttaaaacatgacaaatttgttatcttatagttttgtaggtta
gaagtcctgcatggttctcactgggcttaagttggcacagcagttttcctttctgaaagc
tctagggtagaatgcatttcctaccctttttcagctcctgccacattccttggcttgtag
TCTCTTCCTCTATCTTCAAAGGCAGCCAGCAACAGTGGGCTGGGTTGAGTCCTCATGTTG
TATCACTCTGTTTCACTTTTAAAGAAACTTGTGGTAACATTAAGTCTGCCCGGATAATCC
AAG
gtaatgtccctatttaaaaaaaaaaaattcttttaagagacagagggtctcactctgttg
tctgggtgggagtgcagtggtgcagtcattggttgctgcagtctcgaactcctgggctca
agcagtgctcctgcctcagcccccaaagtatctgggactacaggagtgagccaccatgcc

 1.10 Intr +  25896  25986   91  1  1   58  110    41 0.614   1.43
cttcttggggcggaaatctagaccccctgggaaagcgtatgcctatgtcagaaaagcata
gtacttgagaagcaatgttttcagacaagaacctcactgcatttaacccaatatcattag
cattttaatttggagacttgtctaagcatcatttcatttatgtaatgtcttccatggtag
ATGAAGAAGATAAGGATAGTTTACAGGAACTCTCTACAGAACAGAAATGCTTTGTTGAAC
ACATCCTTTGTACGAAGCCATTGCCCTGCAG
gtaaggactctccctcccttgtatatcagaaaacaattgttcatttcagcagttcagata
cgtttgtatccgttacactcacatccacagtattcactgctgagtcatttgaaagttgca
gacgtgatacttctcccctaagagtgtcctgctcatcagaagctttctcctctccagggc

 1.11 Intr +  29215  29316  102  1  0   85   49    94 0.778   3.57
gactttagtgtggagctgcattaaaggtttccaagccaccacttttgaggttatggtact
gataggatgtcccaagcaacttcagcccaggcctgagaaggccgcggacctgtcatgtct
ttgctcttggttccattgcatttgctgctttgtaatttaactatgactgtgtttttccag
GCAGCCAGCTCCAATTCGAGGATTTTGGATTGTACCTGACATTCTGGGACCCACGATGAT
CTGCATCACCAGTACCTATGAATGCCTCATATGGCCGTTATT
gtacgtcccattttatattctccacacagctcttgttaattctgcaatatctaagttggg
aaaatgcactcagtaaccaacttgaagctatacatgtgtggtttatactttggcttctga
cttgagggttggaaggatggatatttctgttcctgccatcatctctataaggtttcattg

 1.12 Intr +  32925  33098  174  0  0   78   64   129 0.799   7.63
gctactcgagaggctgaggcagaagaattgctcgaacctgggaggtggaggttgcagtga
gccgagatagcaccaatgcactccagcctgggtgacagagcgagactgcatctcaaataa
ataaattaaaaatataaaaagtttaaaaagcacctgtgacttgagtctatttattttcag
TTGTTTTACTCAGCTAAGGAAAATAAAGGTAGAAACTTTGTTTTTAAGAGCTTCTGAAAA
GGACATAGCCCCTCCTCCTGAAGAATGCCTTCAGCTCCTCAGCAGAGCCACCCAGGTGTT
CAGAGAGCAGTACATTCTCAAACAGGACTTGGCAAAGGAGGAGATTCAGCGGAG
gtatgatgtcctgtgttcacaaaccatcgatccctggctggtagctgatgctgtatggta
gcctagacctggcttctgaataaactctatttctttttgtttttaaagggtcaaattatt
atgtgaccaaaaaaagaaacaactagaagatctcagttattgtcgagaagagaggtaagt

 1.13 Intr +  33207  33272   66  0  0   94  107    40 0.923   3.60
cagagccacccaggtgttcagagagcagtacattctcaaacaggacttggcaaaggagga
gattcagcggaggtatgatgtcctgtgttcacaaaccatcgatccctggctggtagctga
tgctgtatggtagcctagacctggcttctgaataaactctatttctttttgtttttaaag
GGTCAAATTATTATGTGACCAAAAAAAGAAACAACTAGAAGATCTCAGTTATTGTCGAGA
AGAGAG
gtaagtgtcaaaaataagaagaatacaataggtcagtaagactggaaccatattctcacc
ctaagatgctgagccacattaggtggtttcagcatcaaggggtggacctcaagagtctct
tgtgtcttacatcattaggaaaagtctgcgggaaatggctgagcgtttagctgacaaata

 1.14 Intr +  33411  33491   81  0  0   43   82   180 0.625  10.73
aaagaaacaactagaagatctcagttattgtcgagaagagaggtaagtgtcaaaaataag
aagaatacaataggtcagtaagactggaaccatattctcaccctaagatgctgagccaca
ttaggtggtttcagcatcaaggggtggacctcaagagtctcttgtgtcttacatcattag
GAAAAGTCTGCGGGAAATGGCTGAGCGTTTAGCTGACAAATATGAGGAAGCTAAAGAAAA
ACAAGAGGATATCATGAACAG
gtcagtgggctgtataacatttagttacctagtcaggtactaacaacgatatttaagaaa
atgggcattggcaggtgcttacatacctacggaactgaactgatccccctgcctctcctc
tgaagtatatgttggggaaaacatgaggctctcccctaacccttcctatggggcctactt

 1.15 Intr +  33767  33893  127  2  1   57   91    91 0.612   6.06
tgaactgatccccctgcctctcctctgaagtatatgttggggaaaacatgaggctctccc
ctaacccttcctatggggcctacttcagaaacaccagattcatgaattatgagcttgtga
ttatgtttctcctaattagtagagaccttaaattgagatgtttgcttgccttttctaaag
GATGAAAAAACTACTTCACAGTTTTCACTCTGAGCTCCCAGTTCTCTCTGATAGTGAGCG
AGACATGAAGAAAGAATTACAGCTGATACCTGATCAACTTCGACATTTGGGCAATGCCAT
CAAACAG
gtaggaatagatccaaactagctaaatttggtaatttttcttaaagcacttattctacag
aaaattttacaaaaatgtaaaaagaacagattcaaatagatactgtgaaaatgtgtggca
aaccactgccaaaatatctattattttaatacttaaggttactatgaaaaaggattatca

 1.16 Term +  34051  34173  123  0  0   33   42   123 0.605  -0.40
atttgggcaatgccatcaaacaggtaggaatagatccaaactagctaaatttggtaattt
ttcttaaagcacttattctacagaaaattttacaaaaatgtaaaaagaacagattcaaat
agatactgtgaaaatgtgtggcaaaccactgccaaaatatctattattttaatacttaag
GTTACTATGAAAAAGGATTATCAACAGCAAAAGATGGAGAAGGTGTTGAGTCTTCCAAAA
CCCACCATTATTCTCAGTGCCTACCAGCGAAAGTGCATTCAGTCCATCCTGAAAGAGGAG
TAA
gtaaatacttccaatcagctattatcgtgagatagtttttcctttacagtatgccagaat
caacctgtcttaatagaaacctgaatcttggtatttgcatgtcaagtaattactgggatg
agagccacatgatacatagggacttaagaaatgactatggtgggaggattgaaagggatg

Predicted peptide sequence(s):


>NUP88_1|GENSCAN_predicted_peptide_1|725_aa
MAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRNV
VFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQ
HHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYP
SEILDPHVVLLTSDNVIRIYSLREPQTPTNVIILSEAEEESLVLNKGRAYTASLGETAVA
FDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTYISLLHSPGNIGKLLGPLPMH
PAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLI
PSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLTW
IHKLHKFLGSVSSSIFKGSQQQWAGLSPHVVSLCFTFKETCGNIKSARIIQDEEDKDSLQ
ELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECLIWPLFCFTQ
LRKIKVETLFLRASEKDIAPPPEECLQLLSRATQVFREQYILKQDLAKEEIQRRVKLLCD
QKKKQLEDLSYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKLLHSFHSELPVLSD
SERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLPKPTIILSAYQRKCIQS
ILKEE