GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:20:20

Sequence NME1_1 : 10851 bp : 46.37% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1122   1280  159  0  0   18   90   125 0.823   4.80
cacgcaacgtgtgagcgccacctctcgggaagccaatttgctcgcgaacgaaggaagtga
gtcagagaacccgggggtggagagaagaaagcaagcagctaaccggaaaggtctgaaaaa
gctagcgccggaagttaaactgcagaaagttgttccctagaatgactgcctactcccaag
AGGAAGCGTGGGCGAGCGGTGTTCTGCAAAATGGGCTCTCCGGCAGCGGATCTGCGCAGA
AGCGTTCCGTGCGTGCAAGTGCTGCGAACCACGTGGGTCCCGGGCGCGTTTCGGGTGCTG
GCGGCTGCAGCCGGAGTTCAAACCTAAGCAGCTGGAAGG
gtaagaggtgttcgggatcctgagaggaaaaagaaaggagtgtagtcgcgggagtgggtt
aggtgaggagttagtgaagagatgagttcagctctaagaggcggcgaggaggatcggatg
ggaggaggggcagggagcgcctgtggacaagtgcagaccggtcggcgcacgtcccacgcc

 1.02 Intr +   3269   3398  130  2  1   95  108   136 0.979  17.00
cacattgacatattagttcatagatcaggggactggggaggaattgggtttttaccagag
ggagacctggagctgacctgacagatttaaaccagctttatgggataatccgcttgagac
ggatgacgctgtaggcaagtgattcactgctgtttcattcctctacctgcctatccccag
AACCATGGCCAACTGTGAGCGTACCTTCATTGCGATCAAACCAGATGGGGTCCAGCGGGG
TCTTGTGGGAGAGATTATCAAGCGTTTTGAGCAGAAAGGATTCCGCCTTGTTGGTCTGAA
ATTCATGCAA
gtaagtggacttcattgttcccattttgattccttcatagtataggagaacactgtgatt
aacctgtttctccccgtctttcttatttaaagttctccacggtagagtgaacacaagtgt
cttgagacctggaaactcctcagtgccctagcgtttggctacatcttggaacaaaccaag

 1.03 Intr +   7598   7699  102  1  0   66  101   112 0.994  10.67
agaagtacatttagtcctgtcactgctcccttccagtgtggagaatgaattgggttataa
cagaatcagtgagcccaaccgctcatgttttacatagcagggtggatgaggggaaattaa
atggattatatgtccttagatggtttgggggttattctcattctctgtcctgttgaatag
GCTTCCGAAGATCTTCTCAAGGAACACTACGTTGACCTGAAGGACCGTCCATTCTTTGCC
GGCCTGGTGAAATACATGCACTCAGGGCCGGTAGTTGCCATG
gtgagtgtgcctgtgtgggatactccaagtatgcattgcttgtcatctgtgctaggctct
cttctagacactggggatacagccatgaatgagaccaaatagatacctgttttcatatac
cagctaatggttagtgataggcttcagaaatgaaatatgcccagaaatgaataggagtag

 1.04 Intr +   8778   8890  113  2  2   55   94   113 0.999   7.78
gggcagggagatcaggatcctcagtgctggaataagtggatatactctataaacatttgt
tcagtgaatgaatataatcttaaggggcctttttatttttccttttttgaattaatagtt
gccagattttctgctgtgattggttttcttctttgaccatatcttcttctgtccttggag
GTCTGGGAGGGGCTGAATGTGGTGAAGACGGGCCGAGTCATGCTCGGGGAGACCAACCCT
GCAGACTCCAAGCCTGGGACCATCCGTGGAGACTTCTGCATACAAGTTGGCAG
gtgagattttggtatttttcccccttttccaaaatctgatttagttgccacaaggatttg
ggtttccgaggctggaggtagacatgataccatatgcaggttgattttatcggagtttat
tgttttcctccctcttaagttggcgtttggctttggttgttaacatcacttagtcgtacc

 1.05 Term +   9346   9463  118  1  1  101   48    97 0.995   5.01
tggatgtggggagggcatttttcagccttaagtgaatggccattgtaggctttttctttt
aacatggtctaatgtccatggagcttcagcttttatgctgctgtggctgtagatttctgg
caatgggcgcattttaatccttctggtcttggtcatgtgactatctctttctccacccag
GAACATTATACATGGCAGTGATTCTGTGGAGAGTGCAGAGAAGGAGATCGGCTTGTGGTT
TCACCCTGAGGAACTGGTAGATTACACGAGCTGTGCTCAGAACTGGATCTATGAATGA
caggagggcagaccacattgcttttcacatccatttcccctccttcccatgggcagagga
ccaggctgtaggaaatctagttatttacaggaacttcatcataatttggagggaagctct
tggagctgtgagttctccctgtacagtgttaccatccccgaccatctgattaaaatgctt

Predicted peptide sequence(s):


>NME1_1|GENSCAN_predicted_peptide_1|207_aa
XGSVGERCSAKWALRQRICAEAFRACKCCEPRGSRARFGCWRLQPEFKPKQLEGTMANCE
RTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLV
KYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVES
AEKEIGLWFHPEELVDYTSCAQNWIYE