GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:15:51

Sequence NGFR_1 : 22094 bp : 56.70% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1187   1379  193  2  1  100   84   140 0.531  14.82
ctctaagggacaaggcagggagaagcgcagcggggtgcggggaaccgcacgccctccctt
tgcctctgcttcccaccccgaggcggcagggcgggcgggcgcggttccgggggtgggcgg
gctgggcggggcggaggcggggccgcagcactggcttcacccagcctctcccgcccgcag
CCAGAGCGAGCCGAGCCGCGGCCAGCTCCGGCGGGCAGGGGGGGCGCTGGAGCGCAGCGC
AGCGCAGCCCCATCAGTCCGCAAAGCGGACCGAGCTGGAAGTCGAGCGCTGCCGCGGGAG
GCGGGCGATGGGGGCAGGTGCCACCGGCCGCGCCATGGACGGGCCGCGCCTGCTGCTGTT
GCTGCTTCTGGGG
gtgagtgttagccggagggggcccgctccctttcccgggatcagaactccgagaagagcc
gggcgccgccaccaaggaaacagaacagagcattggggtcccagatactgagggtgggtg
gtgggaaaggacctctgatgccgggaccacgaaggagggtctagggttcccggagcgcag

 1.02 Intr +   7959   8100  142  2  1  120   79    46 0.913   7.34
tcacttgcctttcccctgtcagctttgatgttcctaacgcctccctggtgagctcatccc
agcccaggtggttctaatagaaggcagtgggaggagggtgtttgattccccggaagaacc
ccccccaacccaccccagctttctcttgccagtctgaccctccgatctccctccatccag
GTGTCCCTTGGAGGTGCCAAGGAGGCATGCCCCACAGGCCTGTACACACACAGCGGTGAG
TGCTGCAAAGCCTGCAACCTGGGCGAGGGTGTGGCCCAGCCTTGTGGAGCCAACCAGACC
GTGTGTGAGCCCTGCCTGGACA
gtgagtagagggtggcgggcaggaggaggggagaagaatgggagggaggagaggggtgaa
agggaggggcgctggggagaagcatgcccagtagaggccttataagaccaccactgtaag
gtcatcagaagtgggtctgacccagtgtaggaggcgcttctcccagattcgagaagctga

 1.03 Intr +  12195  12554  360  1  0   45   96   836 0.990  75.85
gctgccaccaactttcacaggctaggggtcagggtcccttggaagagggtgggagccgat
gagaaggctgaaggaggaagtcagcgtcctggcaggcaataggggagggagagactccag
ctcctgcgtcccgggtgcccaaaagagcagacgactaaatctggtgtccgctgcgctcag
GCGTGACGTTCTCCGACGTGGTGAGCGCGACCGAGCCGTGCAAGCCGTGCACCGAGTGCG
TGGGGCTCCAGAGCATGTCGGCGCCGTGCGTGGAGGCCGACGACGCCGTGTGCCGCTGCG
CCTACGGCTACTACCAGGATGAGACGACTGGGCGCTGCGAGGCGTGCCGCGTGTGCGAGG
CGGGCTCGGGCCTCGTGTTCTCCTGCCAGGACAAGCAGAACACCGTGTGCGAGGAGTGCC
CCGACGGCACGTATTCCGACGAGGCCAACCACGTGGACCCGTGCCTGCCCTGCACCGTGT
GCGAGGACACCGAGCGCCAGCTCCGCGAGTGCACACGCTGGGCCGACGCCGAGTGCGAGG

gtgagtgcggttcggggggcggggggagtgggggtgcgggggtgggctgggggcataagg
aagggcgctctctggaggtcgacaaggaccctgcctggcctgctggggcagcttggtgac
cttgaggcagcgtgcaccttccctgagcttcagtcctttcctggtaacctaagggaggag

 1.04 Intr +  16308  16560  253  1  1   77   94   293 0.981  25.83
cccacaggccttgctctttagcatcatgacatcatgcacgcaatcccagctgtgcataac
agctgggcacaagagcacctggagccagggcggggacacaggaagaacacggcagtgggt
tagagctaaaagggaggagtgggggaagtgggtcctcactcctgtggccttttctcccag
AGATCCCTGGCCGTTGGATTACACGGTCCACACCCCCAGAGGGCTCGGACAGCACAGCCC
CCAGCACCCAGGAGCCTGAGGCACCTCCAGAACAAGACCTCATAGCCAGCACGGTGGCAG
GTGTGGTGACCACAGTGATGGGCAGCTCCCAGCCCGTGGTGACCCGAGGCACCACCGACA
ACCTCATCCCTGTCTATTGCTCCATCCTGGCTGCTGTGGTTGTGGGCCTTGTGGCCTACA
TAGCCTTCAAGAG
gtaagagagggcacggtggcgacagagaggggagatgtttgccctcaaggaagactttgc
tgtgaccttgacctgaaaacatacacacccttttaactcaaccccaaaccaagctcatcc
tcactcatcatctgccgccccactccagggtgcagcaggtcagcaggaggtgaggggaga

 1.05 Intr +  17788  17948  161  1  2  101   84   262 0.999  27.24
atggagctttcagggtaggtgggggcagatgtgcaaagaggagccttagatggtggggtg
gcggttataattgggcacccgccatgcccctggccctcacacggcagagcacagatactc
agctgcatcggccactacagcccctcgccccctgaaacctggcctgtcctctggctccag
GTGGAACAGCTGCAAGCAGAACAAGCAAGGAGCCAACAGCCGGCCAGTGAACCAGACGCC
CCCACCAGAGGGAGAAAAACTCCACAGCGACAGTGGCATCTCCGTGGACAGCCAGAGCCT
GCATGACCAGCAGCCCCACACGCAGACAGCCTCGGGCCAGG
gtgagcagcggcccgctggggagctgaggcggagctgaggctgaggaaacagaagcaatt
aagattagactccaggaaggactgtcgggggggcggcagggctggctcagcggtgcccct
gtagatggatggagaggctggccgaggggaatgggagggagaggtcctctctagaggaac

 1.06 Intr +  18604  18876  273  2  0  110   73   400 0.294  38.75
gacaacgagtccccccaggtgccttcacttcctggtgccccacccaggaccttgtcttgg
ccccaggcctccagatggggaggagcactgcctcggcccttcttgggtctcaccccagtg
cccactgttggggaaaggagttcaggggtaggacctgactctcctctggtttctctgcag
CCCTCAAGGGTGACGGAGGCCTCTACAGCAGCCTGCCCCCAGCCAAGCGGGAGGAGGTGG
AGAAGCTTCTCAACGGCTCTGCGGGGGACACCTGGCGGCACCTGGCGGGCGAGCTGGGCT
ACCAGCCCGAGCACATAGACTCCTTTACCCATGAGGCCTGCCCCGTTCGCGCCCTGCTTG
CAAGCTGGGCCACCCAGGACAGCGCCACACTGGACGCCCTCCTGGCCGCCCTGCGCCGCA
TCCAGCGAGCCGACCTCGTGGAGAGTCTGTGCA
gtgagtccactgccacatccccggtgtgagcccaaccggggagcccccgccccgccccac
attccgacaaccgatgctccagccaacccctgtggagcccgcacccccaccctttggggg
gggcccgcctggcagaactgagctcctctgggcaggacctcagagtccaggccccaaaac

Predicted peptide sequence(s):


>NGFR_1|GENSCAN_predicted_peptide_1|462_aa
XQSEPSRGQLRRAGGALERSAAQPHQSAKRTELEVERCRGRRAMGAGATGRAMDGPRLLL
LLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVV
SATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFS
CQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWIT
RSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCS
ILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQ
QPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFT
HEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCX