GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:35:48

Sequence NARF_1 : 31969 bp : 51.53% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    770   1013  244  1  1   56   59   266 0.489  18.10
gaacacacgcaaatgtcaaatggccatcatttagcatctgccctcgggcttccgggtcca
tcacgtggttactgacaggcaggccgcgcatgcgcgctgctactccgccgagcctacgtg
acacgacgtcaagtggcaatggcggcggacgagggctgtgcccccggcccgccccgttag
GAGCCGCGAGTAAGGCGAGTGTCCAACGCCGAGCTGGCTGACAGAGCCCGGCCGCGGCCT
CCGCGGGCCCAGGGGCCTCCAGGCCCCGTGACCACCGGACCGAGCACCCTGGAACGGCCC
CAGCTTGGCCTCGGGACAGTCCGCGCGCTCACCGACTCCCTGGTGAACGCCGCTTGGCCG
CCGCCGCCGCCGCAGGACCCACGAGAAGCGGAAACCGGCGCAAGGACCCGGTCCCCCCGG
CGCC
gtacgtggagtgagcctgcggtccgccccgcgcgctccgattggctctggggcctggccc
gccccttcccgacactgtcattggcctaggcaaagccgtaagggtggggaatcctattgg
cccaggggtgcggcttgtcctctcccggtgctctcattggccgagcgcggccgttggggg

 1.02 Term +   1447   1883  437  2  2   -2   48   315 0.382  14.33
cctgaggctgaggcgcccggcctcccgcccgccgcgctccagatgaagtgtgagcactgc
acgcgcaaggtgagcgccgcgggccggggaggcgcgcgcctggtgcttgtcctgtggggc
tctgggcggccgaggttggcggtccgggcccgccgctcgctcgcttcagggctcttcaag
GCGCCCCCGGCCTCGGCACCCTGGGCCCGCTCGGCGTGGAGGCGGCCGGCGCGGGGTCCG
CTGCGCTCTGCAGGGCGGGTTCGGTCTTCGCGGTTCTCCCTGAACTTGTCCATCTTTCCC
ACGCCCGCGAAGCGCGGAAACGCACGGAGACCGAGCCTCTCGTGCCGCGCACCACAGTCC
GAGTAAACAGCGGTCGTGGCGGGAATGATCAGAAGCGTTTCGAGAGGGTTTTAGGCGTTT
TCGAACCTGCCCCTCTGAGGGTCACCGAGCAGCCGGTGCAGGGGCGGAAGCGGGTGACGG
CTGCTGACCGGCGCCTTCCGCGGTTGTCTCCAGGCCATGGCAACAACCGCGCAGCGCACG
CAGGGGGGTTTTGTAGCTGTTATTGCCGGAATGGGCTCCTGTGGATGCTGCTCTGTGGCT
GGCACTTCTGCGCGTGA
cgccgtggcaggaggcttcctaacattccatgggtcgttcatccccggtggtggctgcgt
cctattctaagtacacctgtgtccaggggaattcgcctgtggggtgaaggctacagttgc
ttctgcttttttattattgtaaacaatagagatgtgtgtgtgtccttcagtacctgtttc

 2.01 Init +   4328   4450  123  1  0   48   75    62 0.283  -0.89
atttcacgcccagaaggaacattacatgtaagcctggccattatccctgttttactgagt
gaagggtgttgggagaggttaaggtcagtctacccttagaaagtactagtaccagtttat
aaatggagagttggcaatatggcagaagcatattttttccttaagtttagtagtcctgac
ATGTTTAATCTGACAGGTGTTCTCCCGGTTGCCCTGTGTGCCAGTGCTGTGGGGACTGTG
GGGCTTAGGGAGCAACAGGGCCTGAGACAAGCAGCCAAAGAGCTGGCCACAGGCAGAAGA
GAG
gtagggtgcattggagccctggaggcagctggggccagtgcgcctgagtggccgacccca
ggggcctccctcacctgccctctggttgtgtcgttgtagacagatatctaagccctgtga
gcctcgtttccttatcagaggcctggggagtagggttacctccctcccaggactgtggtg

 2.02 Intr +   6792   6935  144  2  0   68  116   140 0.990  15.79
ccaccttgagctgctcagtggcagagactgtcctgcttccagccccttgagcaccaggcc
tggaccctggtattatctccaatgtttactgtgaattctgtatatgggtgttaccctctc
taaagaagcacattaaagagtatttgttgaataatcatgctgaaacgtcatctttcatag
AAGGGAGAATTCCACAAGTTGGCTGATGCCAAGATATTTTTGAGCGACTGCCTGGCATGT
GACAGCTGTATGACTGCAGAGGAAGGAGTCCAACTTTCCCAGCAAAATGCCAAGGACTTC
TTCCGCGTTCTGAACCTTAACAAG
gtaaggcattcggggcatttgctgatgctggggagctgacctggaggaagtggaggtgag
gcctggcttcctgcacagaagcctctgctgggacatcggatgcacatctcagccttttcc
tggtgttgctaacatcctgctttgaccttccaaacctctccatcaagagcaaaatccccg

 2.03 Intr +  11269  11401  133  0  1  119   97     7 0.983   5.42
ctcaccataatcctgattttttttctcctttttcttaattatgtttgccagtgtttgtct
attttattagtctttgcatagaccatctattaacgttgttctgaatttctcattaaggtg
tgtaacttttactccttgtgtaatcagcagatacctaacattctctatttctccttctag
AAATGTGATACCTCAAAGCACAAAGTGCTGGTAGTGTCTGTGTGTCCTCAATCTTTGCCT
TATTTTGCTGCTAAATTCAACCTCAGTGTAACTGATGCATCCAGAAGACTCTGTGGTTTC
CTCAAAAGTCTTG
gtgagtcatcttttgataaattgggaatgtataacttgagtttataagcgccctttttaa
tctctaaagttcgtttttcaaggacgcagggtagataagcaacttccaaaagagtctctt
ggaacgtaaaaagaccatgtcccgtgtgtcatgaaacccagcctctgatcgatggtagac

 2.04 Intr +  15069  15203  135  1  0  124   93   115 0.947  16.65
tgaggtgggaggatcacttgaacctgggaggcggaggttgcagtgagccgagattatgcc
actgcactctagcctgggtgacagaacgagactccgtctcaaaaaaaaaaaaaaagagga
agcctaaaagtagatcttttagtacgtgatttaagctgaatatgctcctctctcctgcag
GGGTGCACTATGTATTTGATACGACGATAGCTGCGGATTTTAGTATCCTGGAGAGTCAAA
AAGAATTCGTGCGTCGCTATCGCCAGCACAGTGAGGAGGAACGCACCCTGCCCATGCTGA
CCTCTGCCTGTCCTG
gtgagcccctggacccccgctctgttggcctgaggtgccaaaagaggtttcacaagattc
tgcaggctctagatgaggttggaggcagacagacccatcccacccagccttgtagaccag
gagggaagagcttggcctgattcacagagggtgtttgatgttttgggacagccaatttag

 2.05 Intr +  18276  18401  126  1  0   75   73    20 0.533   0.36
tcaatcatacatatatactacatacatacagcaaatctcaagctaaaataggaagcaagg
ggctggcctgcagccagtggctggagaagagaaaggatttggtgacacatttctcagaaa
tgccgtcactgagaagagacctctcagggcccctacctagcattgtgttcactgccacag
GCGGAGGGATCACCGTTTCTATACAAATCAGCAATCTGCTCAGGATTCACATCAGCAGAG
TTAGTTCCTTCAGTGACTTGAGAAGGTTCCATCCCAGTAGGACCTCTCATAAGGAAATCA
ACAAAT
gtaaggagactgcaaaaagtttgtggaagaacagaattaaaagataaaaagtataaactt
tatttctcaacataagctccatcctggtcaagacttttttttattttttattttatttat
ttatttattgagacagagtctcgctctgtcacccaggctggagtgcattggtgtgatctt

 2.06 Intr +  21305  21423  119  0  2  120  115   128 0.999  19.39
cacagccgggccaccgaggacgggttttgggtccagcacgagctcctggtaaggcctggg
gaaaaggtgttctggcttcaccctggggcggcagggactcgagctcagcattccctggtg
cgttacaggaagaccagaggaagcagtaaggagctgaccgtggatcccttctctccccag
GCTGGGTCCGATACGCCGAGCGGGTGCTGGGTCGCCCCATCACTGCCCACCTCTGCACCG
CCAAGTCCCCCCAGCAGGTCATGGGCTCTTTGGTGAAGGATTATTTCGCCAGACAGCAG
gtaagctgacctctctggagggcaggaagggcaggtgagggaggaccatggcacaggggc
ccaggaaggggaggttccccatctgtccagcgtggtcacggccccccaggtgagcaaaaa
ggaagctgtggcttcaggaaacatcagcagtgctgtttctcaccaacgcccgtctctatt

 2.07 Intr +  23587  23716  130  0  1  104   94   109 0.971  13.87
aacctggtgacagagcaagactccatttcaaaaaaaaaaaaaaaaaaagagtgcagcatg
cagtgtctggagggcagcagcagggggcattcggtctcccatccctcttgttctgggcac
caagcgtaagctgccgtcacctcttcaccagccctaaatatgggtgcccctctcccacag
AACCTGTCTCCAGAGAAGATTTTCCACGTCATTGTGGCCCCTTGTTATGACAAGAAGCTG
GAGGCTCTTCAGGAAAGCCTTCCCCCTGCTTTGCATGGCTCCCGGGGCGCTGACTGCGTG
TTAACATCAG
gtgagaggtgggcgggggtgcacctgggcgctggggtaatctcctactggccagtacaca
ccagagccaggcagatctgtgtcccagagccatctcagtgcctgccaatgtggtcgcttg
tctgaagttactgacagctgagggtcctaggggcttaactgcaggtgaagagaagggtca

 2.08 Intr +  26221  26284   64  2  1  116   84    41 0.864   4.77
tttattagtgtttcattttattggcctcactttgccctttagatggactcctgctgtgtg
tgatggagatttcataagagggaggtcacccagggtcactaatgtcaaatctcctgcagg
ggaagaaaagttcctgtggccacctgtgtcttttcagtgtcttacttcgtttgtctgcag
GTGAAATTGCTCAAATAATGGAGCAAGGTGACCTCTCAGTGAGAGATGCTGCCGTCGACA
CTCT
gtaagtggcttctctggggagagtcctctggggggcaggacctctcgtcagccctgccag
ccacctgccaggcccagggctgccctgctttatgacgaggccatgtgaagcactgcgatg
cagtcccccaggcccctgccacaaccctcagccaccctatagctgttgaatgggatacca

 2.09 Intr +  26656  26825  170  1  2   48   53    60 0.316  -1.39
tgccagggagttgaaggtttggcgggcttccatggtgtgattgccaccctaaacccttga
ggaaggacaaaatgcacaaacagctttgtcctcgctggcgcagggctgttcatgtgtgca
ccagcccccttcttcctgagtgccgtctgtgcctcacattccgtgtggtctatggggcag
TGGGGCAGCTCCCTCAGGCCCCTTTGCACCAAGAGTGGCAGTCTGGGTTCTGCTGGGGGC
GGTGACCTCGATACCCAGCAAGGCCCAGGGCTCCTGCTGCACCCCAGGCACTGGGCAGAG
AGCACCACAAAGGCAGCAGCGTGTGTCCTCGCCAACAGTCCGCATCCCAG
gtgctgcattcgtgcccttttgggggaaggtaagatagaagtttacagaatttaagcatc
tgtggggccaggcgtggtggctcacacctataatcacagtactttgggaggctgaggtag
gaggatcacttgagtccaggaggctggggctgtagtgagctatgattgtgccactgcact

 2.10 Intr +  27281  27455  175  0  1   39   48   211 0.744  11.71
ctgagagtcctccgccttgcccgagcatcaggcaggccctcccaagacccctcaagatgc
tagaatgggactttctgcaaagtttaaacatctgtacaggatttagcttctttggtggcg
aacttggattgtgatgccctcaggaagtctggtttcactctttctgtcactgtacgtcag
CATTCATGAAGGACTTGTATTTTCTCTGCCTTGTGAGGTTTGGAGACTTGAAGGAGGACA
AAGTGACGCGTCATGATGGAGCCAGCTCAGACGGGCACCTGGCACACATCTTCAGACATG
CGGCCAAGGAGCTGTTCAACGAGGATGTGGAGGAGGTCACTTACCGAGCCCTGAG
gtgtggggcagtatccacagcctgtctgtgcctgtggttagcacgtgtgcatggtgtgcc
tgtatggatctgtgcatgtggcggttctatggatggagtttacactagtcaaaatcaaaa
ggacttttttgtgtttattcagaccttttattttgctgacattccaaacttacattagaa

 2.11 Intr +  28002  28159  158  0  2   67   78   246 0.999  21.67
aagctgaggcaggagaatggcgtgaacccgggaggcagaggttgcagtgagccaagatgg
tgccactgcactccagcctgggcaacagagcaagactccgtctcaaaaaaaaaaaggaag
tgttcttaagtcacagataaaggacttgatggatcaaaattctctgtgttcattttgtag
AAACAAAGACTTCCAAGAGGTCACCCTTGAGAAGAACGGAGAGGTGGTGTTACGCTTTGC
TGCAGCCTATGGCTTTCGAAACATCCAGAACATGATCCTGAAGCTTAAGAAGGGCAAGTT
CCCATTCCACTTTGTGGAGGTCCTCGCCTGTGCTGGAG
gtgaggcgccaagagcagcacctggctctgtctcccacgggtgctcaggccacactggtc
ctgcagctgccagagagatggtgctcttggccacccagagcctctctcagccctgagagc
tttgtagggtatggatgctcccgtggggcttgtgctgggacattctaggctccattggtt

 2.12 Term +  30421  30662  242  2  2  112   45   254 0.894  20.02
ccaggagttcaagaccagcctgagcaacatagcaacacccgcccctcccgcccaatctct
acaaaaaatttaaaaatcagccgggcaaggtggtgtgtgtctgtagttctagctgctcag
gaagctaaggcagaaagatcgcctgagcccaggataaacttacctgtgtttatctttcag
GATGCTTAAATGGCAGAGGCCAAGCCCAGACTCCAGACGGACATGCGGATAAGGCCCTGC
TGCGGCAGATGGAAGGCATTTACGCTGACATCCCTGTGCGGCGTCCGGAGTCCAGTGCAC
ACGTGCAGGAGCTGTACCAGGAGTGGCTGGAGGGGATCAACTCCCCCAAGGCCCGAGAGG
TGCTGCATACCACGTACCAGAGCCAGGAGCGTGGCACACACAGCCTGGACATCAAGTGGT
GA
agtcaggccagggccttccagctgctcttggggccagagccaagagcctctcagtagagg
gaggggctgccctgagtggagtattaaagacacttaagaaaaccgctcaatggattactt
tggtttctccgagttccctgctaccccgtttattggaggcccctcaggcagtttcatgtg

Predicted peptide sequence(s):


>NARF_1|GENSCAN_predicted_peptide_1|226_aa
EPRVRRVSNAELADRARPRPPRAQGPPGPVTTGPSTLERPQLGLGTVRALTDSLVNAAWP
PPPPQDPREAETGARTRSPRRRAPGLGTLGPLGVEAAGAGSAALCRAGSVFAVLPELVHL
SHAREARKRTETEPLVPRTTVRVNSGRGGNDQKRFERVLGVFEPAPLRVTEQPVQGRKRV
TAADRRLPRLSPGHGNNRAAHAGGFCSCYCRNGLLWMLLCGWHFCA

>NARF_1|GENSCAN_predicted_peptide_2|572_aa
MFNLTGVLPVALCASAVGTVGLREQQGLRQAAKELATGRREKGEFHKLADAKIFLSDCLA
CDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVT
DASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRRYRQHSEEERTLPMLTSACPGG
GITVSIQISNLLRIHISRVSSFSDLRRFHPSRTSHKEINKCWVRYAERVLGRPITAHLCT
AKSPQQVMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKKLEALQESLPPALHGSRGADCV
LTSGEIAQIMEQGDLSVRDAAVDTLGAAPSGPFAPRVAVWVLLGAVTSIPSKAQGSCCTP
GTGQRAPQRQQRVSSPTVRIPAFMKDLYFLCLVRFGDLKEDKVTRHDGASSDGHLAHIFR
HAAKELFNEDVEEVTYRALRNKDFQEVTLEKNGEVVLRFAAAYGFRNIQNMILKLKKGKF
PFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQE
WLEGINSPKAREVLHTTYQSQERGTHSLDIKW