GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:46:19

Sequence MNT_1 : 19263 bp : 61.58% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2209   2363  155  0  2   81   11   194 0.730   8.59
tgcggggggcgctcccggcagatctacgcgccgcttggggcggaggcggcctttgcagaa
tgaaatgacatcgcgtgtcttatgatcctggccagccccgcctgaccccgcctcccagag
ctgggctgggctgcgcgtccggggtttgggtgaaagccgggctaattgggcgtttgcgaa
ATGGCCCGCGGGTCGCTGGGGGTCAGCCCCCGGGCCCCCCTCGCTGCGCCCCGCTTTAGC
CAGTGTGGAATGTGGCGTGTCTGCGCGTTCCAAACCCGCTCTCGCCTGGAATGTTGCGTG
TGCCTGCGTTCCGAGCCCGTTGGTTACACCGGGTG
gtgacgtggacgggctccgcccccgaccacgtgcaccggggacactcctgctggggacgg
cgcggcccggcccctcctcaccgcctcgcgctcggccgggggcggggcctgggcggggct
ggcaaggggccttgcgctgggttgggcctgggcccgggccccggcctctgggcacctccc

 1.02 Intr +   6143   6230   88  2  1   97   50    15 0.192  -0.27
tgagggtgatgtccctgtcctgcccatgatgtgacgtggggctcttgtgaggatccaggg
actgtcagcacttccttgtgagcacggcaagcgtcctccaggggtcaggaggcttgctgt
gggacctgcagcgaatcactttgctccctgagcttcactgacttcatctgtgccatgcag
GCACTGCCTGCCCTCTAGAAAGTGCTTGGTAAACATTGTTAAAGGCCTTCCACGGAAGCT
GGGATCTGTCAGCACACCCCCCCCTCTG
gtgtgaagtcttgggtggctgggcctctgcccgcctctcccacctcggccctgtggtccc
ctgaccctcgctgccctcacccgccttcctcctcaccctgcaggctggcaggtggcctgc
agcaccctctgacagctctgctccacctttccagggccgcctgtcctgcccgcagcccgg

 1.03 Intr +   6385   6535  151  0  1  105   70    10 0.308   1.82
gatctgtcagcacacccccccctctggtgtgaagtcttgggtggctgggcctctgcccgc
ctctcccacctcggccctgtggtcccctgaccctcgctgccctcacccgccttcctcctc
accctgcaggctggcaggtggcctgcagcaccctctgacagctctgctccacctttccag
GGCCGCCTGTCCTGCCCGCAGCCCGGACTGTCAGCCCCCGTGACTGTCAGCCCCCGTGAC
TGTCCTACTATTCCCTGGTGGCGGGGAACAGGTCTGCTTGATTTGTTCACTGCTGTGCCC
CCGGCACTTTCCCCCGTGCCTGGCTGGGCTG
gtaggctatttgtggtgtctctcgctgagcaggggtgtcactgagtactgactgggctag
ggtcagaggacgagttagggctggagttctggggccccgctgagaccctcccccccttgt
gttctctctgtgtagaggagcaggagcggcttcgcttggagcaggagcgagagcaggaac

 1.04 Intr +   6671   7250  580  0  1   84   84   291 0.992  21.46
tcactgctgtgcccccggcactttcccccgtgcctggctgggctggtaggctatttgtgg
tgtctctcgctgagcaggggtgtcactgagtactgactgggctagggtcagaggacgagt
tagggctggagttctggggccccgctgagaccctcccccccttgtgttctctctgtgtag
AGGAGCAGGAGCGGCTTCGCTTGGAGCAGGAGCGAGAGCAGGAACAGAAGAAGGCCAATA
GCCTGGCCAGGCTGGCACATACCCTTCCTGTGGAGGAACCCCGCATGGAGGCGCCACCCC
TGCCTCTGTCTCCACCGGCTCCCCCGCCGGCACCCCCACCACCACTTGCCACCCCTGCCC
CACTGACTGTCATCCCTATCCCTGTGGTGACCAACTCCCCTCAGCCTCTACCCCCACCCC
CACCCTTGCCCGCGGCAGCCCAGCCTCTGCCCCTGGCGCCTCGTCAGCCGGCCCTGGTTG
GCGCCCCCGGACTCAGCATTAAGGAGCCTGCCCCCCTGCCCAGCAGGCCGCAGGTGCCCA
CCCCTGCTCCCCTACTGCCGGACTCGAAGGCCACCATTCCACCCAATGGCAGCCCCAAGC
CTTTGCAGCCCCTCCCCACGCCTGTCCTGACCATAGCGCCACACCCTGGAGTCCAGCCTC
AGCTGGCCCCCCAGCAGCCGCCCCCACCCACGCTGGGGACCCTGAAGTTGGCACCAGCTG
AAGAAGTCAAATCCAGTGAACAGAAGAAGAGGCCCGGGGG
gtgagtggggtgtggcggggtcgggctggtgggggataggagaggtgcccatcccccggg
ctgtgtgcaagacaaggtgccctccccagcttagaagtgccccctgtatttgaacacgtc
atcactgtgcccatgtctatcctgggaaggaatgtcccattgccccccgttcccaggctt

 1.05 Intr +   7779   7820   42  0  0  103   89    42 0.950   4.29
agcacagatgtgtcctccagggggtgggcgcagcatggcacagggcgaacgtctcccagt
ctgctttaagacagtgttggggacaaacagcctgtggcaattttgcgggtggcggcgctg
gtcaggaaggccgtctaatcgagtcctcctccctgagcctcctatctgtctgggtttcag
GATCGGAACCAGAGAAGTCCACAACAAATTGGAGAAGAACAG
gtgtgtgtgtgtgtgtgtgtgtgtgtgcgtgcgtgcgtgcgcgcgcgacccgggccccgg
cggccctcggccccagcttccccggtcctgcctccccccgtcccagccccgccccaggca
ccgctgaccggcgctcgcccctctcttcaggagggcccatctgaaagagtgctttgagac

 1.06 Intr +   7971   8082  112  0  1  103   80   274 0.999  29.65
agaagtccacaacaaattggagaagaacaggtgtgtgtgtgtgtgtgtgtgtgtgtgcgt
gcgtgcgtgcgcgcgcgacccgggccccggcggccctcggccccagcttccccggtcctg
cctccccccgtcccagccccgccccaggcaccgctgaccggcgctcgcccctctcttcag
GAGGGCCCATCTGAAAGAGTGCTTTGAGACCCTGAAGCGGAACATCCCCAACGTGGATGA
CAAGAAGACGTCCAATCTGAGCGTGCTGCGGACGGCGCTGCGGTACATCCAG
gtatggggcccggaggccggcgtcgcgcagcttcccccgccctccctccgccgcccctcc
cccggccgcgccccgccccgccctcacgccccggcggctcccccgcgcctccctcccacc
tccacgcgggcgctgagcacatggcccggctgacgtcagcggggctccctgcccgggagg

 1.07 Intr +  14076  14268  193  2  1   47   93   412 0.978  37.88
ctcactgggcaggggcatggaccacaacaggtgcggtctccagcagcccccgtcaggctg
ggcccgctggttgccacggacttgcctctgtgggccagctgatagggagaggtttgtggg
ggctttgggccccaaggctgctgctcagggtgtcctgctgtcccttactctgtgtgccag
TCCCTGAAGAGGAAGGAGAAGGAATATGAGCATGAAATGGAGCGGCTGGCACGTGAGAAG
ATTGCCACGCAGCAGCGGCTGGCAGAGCTCAAGCACGAGCTGAGCCAGTGGATGGACGTA
CTGGAGATTGACCGCGTGCTGCGGCAGACGGGCCAGCCCGAGGATGACCAGGCCTCCACC
TCCACCGCCTCTG
gtgagccccagcccccacgctggccccccagccctcagatgttacacctcaaattccagc
ctccctggccaggctctttcttgcctgctagaaaagatggccctggccccagccccatca
cattcccacgcccccacgagcatctacgcctccagccacttgcttccccgcccttctgac

 1.08 Term +  14476  15224  749  2  2  124   55   732 0.999  68.37
ccagccctcagatgttacacctcaaattccagcctccctggccaggctctttcttgcctg
ctagaaaagatggccctggccccagccccatcacattcccacgcccccacgagcatctac
gcctccagccacttgcttccccgcccttctgacctgctccctgccccatgttccccacag
AGGGTGAGGACAACATAGACGAGGATATGGAGGAGGACCGGGCGGGCCTGGGCCCACCTA
AGCTGAGCCATCGTCCCCAGCCGGAGCTGCTGAAGTCCACCCTGCCACCCCCCAGCACCA
CCCCTGCGCCTCTGCCTCCACACCCACACCCTCACCCCCACTCCGTGGCCCTACCTCCTG
CCCACCTCCCCGTGCAGCAGCAGCAGCCACAGCAGAAGACCCCTCTGCCAGCCCCTCCTC
CCCCACCGGCTGCCCCTGCCCAGACACTGGTGCCAGCTCCAGCCCATCTGGTGGCGACGG
CTGGGGGTGGCTCCACGGTCATCGCCCACACAGCCACCACTCACGCTTCAGTCATCCAGA
CTGTGAACCACGTTCTGCAGGGGCCAGGCGGCAAGCACATCGCCCACATCGCCCCCTCGG
CCCCCAGCCCTGCGGTGCAACTGGCGCCTGCCACACCCCCCATTGGGCACATCACTGTGC
ACCCTGCCACCCTCAACCATGTGGCCCACCTGGGCTCCCAGCTGCCCTTGTACCCGCAGC
CCGTGGCAGTGAGCCACATCGCCCACACCCTCTCGCACCAGCAAGTCAACGGCACGGCCG
GCCTGGGGCCCCCGGCTACTGTCATGGCAAAGCCGGCCGTGGGGGCTCAGGTGGTGCACC
ACCCCCAGCTGGTGGGCCAGACCGTGCTCAACCCTGTGACCATGGTCACCATGCCCTCCT
TCCCAGTCAGCACACTCAAGCTGGCTTGA
ggacgaggccactcagaggcccccagtggggacagggagggggacctgtcccccactctc
tcacccaccagctccacacattccagccaggcccaggccagcccccccacccacccccag
gcctcctaggggaagggggtgcaaagactctgagccaagggagggaagggccaccctgct

 2.03 PlyA -  16648  16643    6                               1.05
 2.02 Term -  16778  16712   67  1  1   84   48    57 0.347  -0.39
 2.01 Init -  17103  17042   62  0  2   80   47   115 0.437   5.42

Predicted peptide sequence(s):


>MNT_1|GENSCAN_predicted_peptide_1|689_aa
MARGSLGVSPRAPLAAPRFSQCGMWRVCAFQTRSRLECCVCLRSEPVGYTGWHCLPSRKC
LVNIVKGLPRKLGSVSTPPPLGRLSCPQPGLSAPVTVSPRDCPTIPWWRGTGLLDLFTAV
PPALSPVPGWAEEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPAPP
PAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQPALVGAPGLSIKE
PAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHPGVQPQLAPQQPPP
PTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECFETLKRNIPNVDDK
KTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELKHELSQWMDVLEID
RVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHRPQPELLKSTLPPPST
TPAPLPPHPHPHPHSVALPPAHLPVQQQQPQQKTPLPAPPPPPAAPAQTLVPAPAHLVAT
AGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQLAPATPPIGHITV
HPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPATVMAKPAVGAQVVH
HPQLVGQTVLNPVTMVTMPSFPVSTLKLA

>MNT_1|GENSCAN_predicted_peptide_2|42_aa
MGIAKLALPEPRGLAEVAVLGPLPQPISVSFTSRDTGFLPLH