GENSCAN 1.0	Date run: 15-Jan-104	Time: 16:17:32

Sequence MAPK7_1 : 8186 bp : 56.40% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2349   2580  232  2  1  111  105   474 0.999  49.81
cccccggctctgggcccggacccctggggtagctagtctgccacgaaccagccgcgcgct
tctgcccttgtcggtttaggaaactgggaagttccctggtcctgctccccagcccgcaga
ggggacactgaggcccacggtaggtggtcctctcctcacccgagtctccacacagacacc
ATGGCCGAGCCTCTGAAGGAGGAAGACGGCGAGGACGGCTCTGCGGAGCCCCCCGGGCCC
GTGAAGGCCGAACCCGCCCACACCGCTGCCTCTGTAGCGGCCAAGAACCTGGCCCTGCTT
AAAGCCCGCTCCTTCGATGTGACCTTTGACGTGGGCGACGAGTACGAGATCATCGAGACC
ATAGGCAACGGGGCCTATGGAGTGGTGTCCTCCGCCCGCCGCCGCCTCACCG
gtgagcttcctgagccgtcgcctcccagatgtggcagcgtcgcagggagtgggaaaccgg
cctgtcccagacagccgggaaggaaagcggggtgcgagttctggctccagtcaacacaca
ctgaccagggccttctgcctgccaggctccggggaggctcggttctctgaaactccggcc

 1.02 Intr +   3230   3395  166  0  1   99   38   413 0.998  36.93
gaaggtaacatttaataatgtaggtaacatgcttagcacagggcttggcacatagtaggt
acccaatacttggtagctgttgtcatttgcatcctagaagggaggtgttgataggggctg
agtcgactctgcagtttctccaaggtatcctctggtatgtcccttttccctgctcctcag
GCCAGCAGGTGGCCATCAAGAAGATCCCTAATGCTTTCGATGTGGTGACCAATGCCAAGC
GGACCCTCAGGGAGCTGAAGATCCTCAAGCACTTTAAACACGACAACATCATCGCCATCA
AGGACATCCTGAGGCCCACCGTGCCCTATGGCGAATTCAAATCTGT
gtaagaagcgggatgggagagggagccagacttgggacttttctgaaggctgcaaccatg
ttgccgaagttctggaaaggcagctgaatctaatctgaagcaggctgggaaaattcccgc
agttctaggaccagttctttagagttttgccagggacaactgttattcctcaagaagtgt

 1.03 Intr +   4056   5134 1079  0  2  130   36  1092 0.485  98.74
ggaaaagtcgtagagaatctaaaacgtgatgctcttcttccataccatgccgtcagcccc
tatggggtcccagggtaaggctgttacctgtctggaatcggaagggtgtggtgaggatgg
ggcttgtccctggagtgtgatcaggccaacccatgcttctctccttccttccccttccag
CTACGTGGTCCTGGACCTGATGGAAAGCGACCTGCACCAGATCATCCACTCCTCACAGCC
CCTCACACTGGAACACGTGCGCTACTTCCTGTACCAACTGCTGCGGGGCCTGAAGTACAT
GCACTCGGCTCAGGTCATCCACCGTGACCTGAAGCCCTCCAACCTATTGGTGAATGAGAA
CTGTGAGCTCAAGATTGGTGACTTTGGTATGGCTCGTGGCCTGTGCACCTCGCCCGCTGA
ACATCAGTACTTCATGACTGAGTATGTGGCCACGCGCTGGTACCGTGCGCCCGAGCTCAT
GCTCTCTTTGCATGAGTATACACAGGCTATTGACCTCTGGTCTGTGGGCTGCATCTTTGG
TGAGATGCTGGCCCGGCGCCAGCTCTTCCCAGGCAAAAACTATGTACACCAGCTACAGCT
CATCATGATGGTGCTGGGTACCCCATCACCAGCCGTGATTCAGGCTGTGGGGGCTGAGAG
GGTGCGGGCCTATATCCAGAGCTTGCCACCACGCCAGCCTGTGCCCTGGGAGACAGTGTA
CCCAGGTGCCGACCGCCAGGCCCTATCACTGCTGGGTCGCATGCTGCGTTTTGAGCCCAG
CGCTCGCATCTCAGCAGCTGCTGCCCTTCGCCACCCTTTCCTGGCCAAGTACCATGATCC
TGATGATGAGCCTGACTGTGCCCCGCCCTTTGACTTTGCCTTTGACCGCGAAGCCCTCAC
TCGGGAGCGCATTAAGGAGGCCATTGTGGCTGAAATTGAGGACTTCCATGCAAGGCGTGA
GGGCATCCGCCAACAGATCCGCTTCCAGCCTTCTCTACAGCCTGTGGCTAGTGAGCCTGG
CTGTCCAGATGTTGAAATGCCCAGTCCCTGGGCTCCCAGTGGGGACTGTGCCATGGAGTC
TCCACCACCAGCCCCGCCACCATGCCCCGGCCCTGCACCTGACACCATTGATCTGACCCT
GCAGCCACCTCCACCAGTCAGTGAGCCTGCCCCACCAAAGAAAGATGGTGCCATCTCAGA
CAATACTAAGGCTGCCCTTAAAGCTGCCCTGCTCAAGTCTTTGAGGAGCCGGCTCAGAG
gtgccttgtgggcaggtcgggtgggcagaggggagacttggacttggacaaggcttcagg
cttttaccttctcccctgcccaacttccccgcagatggccccagcgcacccctggaggct
cctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaagcgg

 1.04 Intr +   5229   5914  686  1  2  114   94   338 0.990  28.92
accaaagaaagatggtgccatctcagacaatactaaggctgcccttaaagctgccctgct
caagtctttgaggagccggctcagaggtgccttgtgggcaggtcgggtgggcagagggga
gacttggacttggacaaggcttcaggcttttaccttctcccctgcccaacttccccgcag
ATGGCCCCAGCGCACCCCTGGAGGCTCCTGAGCCTCGGAAGCCGGTGACAGCCCAGGAGC
GCCAGCGGGAGCGGGAGGAGAAGCGGCGGAGGCGGCAAGAACGAGCCAAGGAGCGGGAGA
AACGGCGGCAGGAGCGGGAGCGAAAGGAACGGGGGGCTGGGGCCTCTGGGGGCCCCTCCA
CTGACCCCTTGGCTGGACTAGTGCTCAGTGACAATGACAGAAGCCTGTTGGAACGCTGGA
CTCGAATGGCCCGGCCCGCAGCCCCAGCCCTCACCTCTGTGCCGGCCCCTGCCCCAGCGC
CAACGCCAACCCCAACCCCAGTCCAACCTACCAGTCCTCCTCCTGGCCCTGTAGCCCAGC
CCACTGGCCCGCAACCACAATCTGCGGGCTCTACCTCTGGCCCTGTACCCCAGCCTGCCT
GCCCACCCCCTGGCCCTGCACCCCACCCCACTGGCCCTCCTGGGCCCATCCCTGTCCCCG
CGCCACCCCAGATTGCCACCTCCACCAGCCTCCTGGCTGCCCAGTCACTTGTGCCACCCC
CTGGGCTGCCTGGCTCCAGCACCCCAGGAGTTTTGCCTTACTTCCCACCTGGCCTGCCGC
CCCCAGACGCCGGGGGAGCCCCTCAGTCTTCCATGTCAGAGTCACCTGATGTCAACCTTG
TGACCCAGCAGCTATCTAAGTCACAG
gtgagagggaggcccaggccatggggacacctgggtctgggccaaaggaaaatgggttca
ggaagcggtcagtgttccacaaaaactgagcagcagatggggctttatctctgaacgtgt
cctcttgctcacagaaggagcataatggcaatgaagaggttgttaggagacaagttaaat

 1.05 Intr +   6261   6394  134  2  2  100   82   180 0.999  18.55
gagacaagttaaatatggcctgcaaagtgcctagcccagagatggggccagccagcactc
actgactgccgagactggtgttagcactcccagatatccaggcggagtagtcagcagcat
tgggacagggtggcctacagacctcagtctgtctgcattgtaacctgtcattccctgcag
GTGGAGGACCCCCTGCCCCCTGTGTTCTCAGGCACACCAAAGGGCAGTGGGGCTGGCTAC
GGTGTTGGCTTTGACCTGGAGGAATTCTTAAACCAGTCTTTCGACATGGGCGTGGCTGAT
GGGCCACAGGATGG
gtaaggtggctggactgagctcctagactgggactgtggggagaggttcctggtgcagga
gacatgcacctgtgggatgggtgagggtccagcctaggctaatagcacccctccctttcc
ttcccctgcagccaggcagattcagcctctctctcagcctccctgcttgctgactggctc

 1.06 Term +   6526   6679  154  1  1  111   54    91 0.995   5.71
tcttaaaccagtctttcgacatgggcgtggctgatgggccacaggatgggtaaggtggct
ggactgagctcctagactgggactgtggggagaggttcctggtgcaggagacatgcacct
gtgggatgggtgagggtccagcctaggctaatagcacccctccctttccttcccctgcag
CCAGGCAGATTCAGCCTCTCTCTCAGCCTCCCTGCTTGCTGACTGGCTCGAAGGCCATGG
CATGAACCCTGCCGATATTGAGTCCCTGCAGCGTGAGATCCAGATGGACTCCCCAATGCT
GCTGGCTGACCTGCCTGACCTCCAGGACCCCTGA
ggcccccagcctgtgccttgctgccacagtagacctagttccaggatccatgggagcatt
ctcaaaggctttagccctggacccagcaggtgaggctcggcttggattattctgcaggtt
catctcagacccacctttcagccttaagcagccacctgagccaccaccgagccatggcag

 2.02 PlyA -   7130   7125    6                               1.05
 2.01 Term -   8135   7910  226  1  1   86   49   310 0.998  23.48

Predicted peptide sequence(s):


>MAPK7_1|GENSCAN_predicted_peptide_1|816_aa
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP

>MAPK7_1|GENSCAN_predicted_peptide_2|75_aa
XGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKG
FYYSLKRTEMKIRRA