GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:13:35

Sequence MAP2K6_1 : 131033 bp : 41.05% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.10 PlyA -    123    118    6                              -1.75
 1.09 Term -   1424   1080  345  2  0   65   53   192 0.027   6.91
 1.08 Intr -   9276   9151  126  0  0   47  110    23 0.013   0.36
 1.07 Intr -  10741  10636  106  0  1  100    8    94 0.069   1.90
 1.06 Intr -  28431  28270  162  2  0   53   92    76 0.079   2.67
 1.05 Intr -  28949  28730  220  0  1   26   93   156 0.235   6.34
 1.04 Intr -  38928  38871   58  0  1   87  102     8 0.106  -0.36
 1.03 Intr -  44021  43855  167  0  2   41   99   145 0.960   9.66
 1.02 Intr -  47955  47827  129  1  0   54  109   150 0.728  13.45
 1.01 Init -  57284  57227   58  2  1   55   99    25 0.126   1.82
 1.00 Prom -  57825  57786   40                              -6.95

 2.03 PlyA -  58891  58886    6                               1.05
 2.02 Term -  64053  63846  208  2  1   85   47   197 0.309  11.13
 2.01 Init -  71806  71751   56  1  2   59   84    34 0.433   0.91
 2.00 Prom -  78784  78745   40                              -2.05

 3.01 Init +  83680  83791  112  0  1   88   63    74 0.493   5.32
actacttccagtactactactatgcttctgttcctttgttcctcttatgcagtaagtgac
cagagcctatagattttgcctctgcaaaattcaagcagcttatttgtgagccagattgct
gtggtctctacctcttatttttgggtctagtgcttaaactctgtacataggtaagaagac
ATGGGCCCTGACTTCAAAGGGCTTGCATTTTTAGTGGAAGACATGGATGAACAGATGGGT
TCACTTAATCAGCATAGGAAGGTTCAGGGTACTGTGGCAACACAGAGGAAAG
gtatttattgcattggggactttcatggaagacttcctggagaaaaacatacttgagctg
agtgtcgcagttgactggggaaaacaggtaataacaacattctgaggaaaataagagcaa
agacctggaggcataaaacatcaaggcatgagagtatgtgggtttatgcatgagtgtgtg

 3.02 Intr +  92283  92349   67  1  1  133  113    47 0.970   8.74
tctgtcctacctggtgcttgggttcttaacactcacagacttcctgggtaggaagtggcg
ctttgaatggagacatgagagctgcctgtgcaggtcagctctttcctttgccgcagtctc
tttctctgctatcttgctatgatttagtccttaactttttccttttgtctttccccatag
GCAAGAAGCGAAACCCTGGCCTTAAAATTCCAAAAGAAGCATTTGAACAACCTCAGACCA
GTTCCAC
gtaagttgacaagaccatcatctgaatccaaatccttgtgctttcagattcctcctgggg
gtttatttttggactgctgagcaatgccttgactttagaagagccctttaagggggaagc
catttgctcactgttctgagacctgaaatagtcatcttatcagtcagttacgttgaatgg

 3.03 Intr + 103358 103406   49  2  1   97  110    24 0.995   3.26
ttaaacccaaatgtgatttatttcaaatcccctcttattcacactcataggctgctttag
tttactcatgaacttccactttcttcttaaggaaaaaatatcctcagtggtgtgtgattt
gggaaggacataattgactcaatagcttatgtttcttcttttcccccttatctttcttag
ACCACCTCGAGATTTAGACTCCAAGGCTTGCATTTCTATTGGAAATCAG
gtaagaaaaaatcatgtctgccacctaatacgttggccattttatatgtatgctttctga
ctgaaaaatttattttccctagcatgctgtcaggggatgagtcaaaaaaagtttgcattt
aaagggaagtggtatgcaaagtttttgctattttgaaagaatgttgaattgaaatcaggc

 3.04 Intr + 104003 104116  114  1  0  121   75   123 0.930  14.02
agacatctcttggcccttcttgtagcttcttgctttcagaggctgctttgacatgctaga
aaatcttctggcccagaaataatccttagaacattgagagaaacgagatagaggataatg
tgctctctgttctgtttatttttctctttcccattgcattattccttttctctcttgcag
AACTTTGAGGTGAAGGCAGATGACCTGGAGCCTATAATGGAACTGGGACGAGGTGCGTAC
GGGGTGGTGGAGAAGATGCGGCACGTGCCCAGCGGGCAGATCATGGCAGTGAAG
gtagagttgacattctcccaaatgttttatatctgctgtgtatacatttgtccacctcaa
ttgtcaaccagcccttttaatagaagcaaaaccatcttccgtagggtaaaacagaaaaga
ttatttgcagggaacagtattttcctccaaaggtatggaaaagtcttccttggtgtgagt

 3.05 Intr + 105816 105935  120  2  0   45   92   149 0.875  10.77
atgagtaacagccttccttattttcatgtgttacaaatagctaatcactttgggtggcta
ttcacaatgtcatcgccagaacttgtgtcatgaactattttcacgatgggactccttcag
gtccctgcctgcctcatcctcagagtagtaaccataaattttccatgcatttccattcag
CGGATCCGAGCCACAGTAAATAGCCAGGAACAGAAACGGCTACTGATGGATTTGGATATT
TCCATGAGGACGGTGGACTGTCCATTCACTGTCACCTTTTATGGCGCACTGTTTCGGGAG

gtaggtgacccttcaattcaaagtccaagaggaacaataacttaaaaagaagtttctttg
atcacgtaaatgccttcacaatcatggagctctttcttgtttgacacatcttgtatacgg
gggtttacgtgtgtgcaatgatgacatgccctggagcaaggttggattgaaattatggta

 3.06 Intr + 106773 106889  117  2  0   51   65    92 0.884   2.94
tagataaccttgcttatttgtaaattcctttatgatcttgacagaagacactgtatttcc
ccccaaaattcaagaaagaaatagttaattcttcaggatagggtttactgtttttttttt
ttatttttatttctccctttttcatccttttaaacaattcctgaaacaattggtctccag
GGTGATGTGTGGATCTGCATGGAGCTCATGGATACATCACTAGATAAATTCTACAAACAA
GTTATTGATAAAGGCCAGACAATTCCAGAGGACATCTTAGGGAAAATAGCAGTTTCT
gtgagtacattttgatccctactgcaaggataatgtgagaaataaagtccctatgtgtct
ttggacctcagtatgaagaaatactacctgggccacagctactattcgtacatgtctgtt
gacatttattggtggatggataaatacatgctttcctttctgagcactgtgtagaagatt

 3.07 Intr + 107552 107603   52  1  1  124   99     6 0.916   2.86
tctggtggatggagtccaatttgtgtaacttcctatgtattttcctagataggaccacca
ctatttgagaaaatatctcactggtaacctaaagccaaggataataaaccttgatatact
taacattcaatttctttccagcaatgtgataaataaatctatcttgtgtttctcttgcag
ATTGTAAAAGCATTAGAACATTTACATAGTAAGCTGTCTGTCATTCACAGAG
gtaagcatccatgagctgccttggctgttcctttgataaagttcatctctttcacctgga
gtccgtctctacccccagtcccccatgggtggaagtagaattgactcaggcaagagaact
aaggggctttcctttgagattggatagcaaaccatataagtagtattccttatcatggct

 3.08 Intr + 110017 110144  128  2  2   92   97   113 0.987  12.08
tcaagttgaaagcaataagctgttgttaactgtgggtcagggatggcagttacttctgtg
ttgggcagcttggggaaaggaagatgaaggacaaatggagattttaggccctctggtggc
agagaaatgaaccttgaaagcaggctgaaatgatggcatcctggttgttttcgctttcag
ACGTCAAGCCTTCTAATGTACTCATCAATGCTCTCGGTCAAGTGAAGATGTGCGATTTTG
GAATCAGTGGCTACTTGGTGGACTCTGTTGCTAAAACAATTGATGCAGGTTGCAAACCAT
ACATGGCC
gtaagtacattagctagggtggcatctggtaatgtcactgccgacaaatcatgctgggaa
acaagaaatggatggccacagagggaaaatggaaatgtacctaagactccagaagtagtc
tgcctcttagtatttcttcaaaattttatgtctgaaatctttactcacttgcttcgtata

 3.09 Intr + 113073 113212  140  2  2  111   83    67 0.460   6.84
aggaatttggggaaaattgctagagaacaaattattagtttatttcctgcccccctaccc
ctggacttatacttgaactttgccttgtgtttcctgctgtctatccacaaatgaaacgtg
ggtgattccctaaagcagccctgttgaaactgttgtctccttttttcttcttttctccag
ATTGAGTTGGCCATCCTTCGATTTCCCTATGATTCATGGGGAACTCCATTTCAGCAGCTC
AAACAGGTGGTAGAGGAGCCATCGCCACAACTCCCAGCAGACAAGTTCTCTGCAGAGTTT
GTTGACTTTACCTCACAGTG
gtaagacagcctcacctcccaagtgtcagtgtgaaagaagaagatgagttctcatgaatt
tcttccatcggggttgaatccatcatgcatacattcattccgaaagcatttgtggagtat
gccctctctgctggagaagcaaagatgaccgtatcacactccctgccctcactgagccca

 3.10 Intr + 122618 122663   46  2  1   74  101    41 0.111   1.49
ccagggtgatttaaaacatgatacataagtgttacagaagaggaaagtcaagataggagg
ctgtgttttcaatacacttttaaagctgattatgtttagtgttctacaggttctgaaatc
cttgtctaatgaaaatatatatggcttctagattttaatgattatttttttttctttaag
CTTAAAGAAGAATTCCAAAGAACGGCCTACATACCCAGAGCTAATG
gtgagtattgttagcaacgtaaacatgactatactgatagctacaaaaggcaaagtcact
aagacctaaattatcatcacatcaccatattggaagagttggttcattgatacatcagtg
acaggaattgaactccaggaaagagagttaaagagttcatcctacatccttcttaaacat

 3.11 Intr + 126163 126364  202  0  1   61  111    72 0.103   4.74
aaaacccacacaagaaggcaagtcacactttccatttgtcatgcctacccgttttcccct
ccccctgcccttctggctctcatagcattttctcaacctgggaataaatggaaagatgcc
tagcgattttctttttttttgattaaagacttcaagtcaggttatttaattcatttgcag
ACTCAGGCAACATCTACTGAGCTAATAGCCACTAGCAGAACAAAAGGCAAGGTGGGGCTG
GCAGGTGTTGGAAGCAGTCACCAAGATAATCTGAGGTTTGGCATGTCCTGTTTTGATAGT
AAAAAGCTTTTAAGTACATTAAAAGATTTCCAAATGTCCAGAGGATGTGGGAAAGCTAAT
AAGCATGATGGTAGAGTCCTTG
gtaagtgtgctgtgtatgtggtgactaatcagaagtatggctgctatttagtttttgagg
gagctcaggaggaaggacctggcactcagagcttcagttgatttcatgagtgtaaggatc
ggagccagcactcaacctgtgtcctcagatgggcaaagggagaaaatctcttttccattt

 3.12 Term + 130637 130749  113  0  2   86   44    52 0.008  -1.66
atgttccagccaccagagatttggatttaactggtggggcctaggaattggtgttttttt
gttttgttttgttttttacacaccttcatgtgattctgatgtgaagctgggttcagaaca
cttatctagtaccttctaaagagaactgacttaaatttactttcttttgaacatttgcag
GGAGTAACATGCCATTGCAGAAAGTAACAAAAACAGGTCCTATTTCTTTCCCTGTCCTCA
TCAGTGGAAATCTCTTTGTCACTCTGAGAGAAGGCATGTACCTGGGATACTGA
taggaagtgtagaacaccttttccccagagaagcaatattttgcactgttattaaatatc
ttacacggtaaagtcaaaagaatgacctgatagcctcacaagactaaattttagagcatg
gttttgtttttggaaaactgtgttgtaagtgccaatcaaccaacttttgaaaaaatcaag

Predicted peptide sequence(s):


>MAP2K6_1|GENSCAN_predicted_peptide_1|456_aa
MCEEVVSSSRQTAPGNKNRELAAEIGRNKSPLKEKRMKTGPVTALILSIASGPRAAGYVH
RAGCWSASPGTILGVASPQGRTDFNKKRIPYENSNLSSYVHSDIHTNTNCGPNTEDFQLS
GNELWIQYSDIQGRNREVIKYEVVADEVRSVFQGGRPSGLRIQGEARSREQDLEVAIMRG
KIQRSGNSEVLLEQQHTSREKPLWEASTFGSQRTVSGGLGGSLKHPHLSVTGSPFSPGAN
RGPVENLDVYTHLAVRRQHPLSATRPSIKTFSPKYTQYPRCKRLCEHKEYSSSKENCPPG
PWANWLTTIDFLTRKLRIITPTLSIVFMGHPKAYYMKSNWLRLVLQQRCKLQACNLHASG
VSLDRCSRWTFRESRWKCTPCKTDWKVIFPPVATLGKAVLQLHDGPGLAAKSSKLGTEYL
SAQTSFLRRARRPLGNVVLRRSPRGSDLRKRGRPGR

>MAP2K6_1|GENSCAN_predicted_peptide_2|87_aa
MTQKWFPSQELPTSLSGHIPRCSLPIQQRFQPTSKQVQLDGTSFLAVPDAFYLWTPALRL
LRHLKKASGTADMHNLGAKTCGTSCDQ

>MAP2K6_1|GENSCAN_predicted_peptide_3|419_aa
MGPDFKGLAFLVEDMDEQMGSLNQHRKVQGTVATQRKGKKRNPGLKIPKEAFEQPQTSST
PPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATV
NSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQ
TIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSV
AKTIDAGCKPYMAIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQC
LKKNSKERPTYPELMTQATSTELIATSRTKGKVGLAGVGSSHQDNLRFGMSCFDSKKLLS
TLKDFQMSRGCGKANKHDGRVLGSNMPLQKVTKTGPISFPVLISGNLFVTLREGMYLGY