GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:22:23

Sequence LLGL2_1 : 51882 bp : 56.13% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    627    948  322  1  1   69   85    85 0.099   1.77
gaggacggcgcgccatcggcccttccctgggcgcagcggggtgcgggtggcgagaggcgc
cacctgcagctgggcggtggagcgcgctgcagccccggcctccgcgccctttccgctccc
gcctctcgtcgctccaacctcctccctcgcttgtgctaaaaattccacccgctgttgcag
ACCCTCCGGCCGACACGGAGGAGGTGGGCGCCCCCCCGCACCCCCCCCCGAGGAAAGGCG
TCTCGCCGCGACGCCCCGGTCCCTACACCATCCCTCTCGTGGGGCTGGAAACCCGGCCCT
GCGTCCCCCGGTCACCCTCTCTGGGCTGGGCTCTGGCAGAGGAGCTGGCCCGGATCCGCC
CCTCCCTCGGCAGCTCCCGGGAGTTGGAGGGACGGCTCCCCTGGAGTCTGGGAGGCGGCC
CGGGACCGCAGGCGTTCCGGGAACTATTTCCGCTTGCGGGAGGCGGCGGGACACTGGGCG
CGGCGCGCCGTTCTGCGTCCAG
gtgcgcgcaggtgaggccggggcgggcctgcggaaccccgaggccgttcgcgaggccccg
ccccgcgcttcccggggccgcggattggcaggagcgcagcccccacccccgagggtgccc
ccgcccctgcggcgccgagctggggggcgggccgggggcggggcgctgggccccggcagg

 1.02 Intr +  10467  10671  205  0  1  102    2    95 0.031   2.03
gggccactctgaatcgatcacttcataagtaattgtaagaattaaataaggtgaatgtaa
agtgctaaagtcacatccagccatagctagctctcaatcccttttactacttaattaaca
acagcggggacgacagtcctccagtcatgcccccattccctctggtttgtgttcccctag
ATCCCACTCCATGGAACTGCCTTTCAGCCAAGGTTTGGTTGCTAAGCTGCTGGCCAGGGA
CCTGCCTGGTGCTTCTGGGAGACTGGGCTTCCCAGGGCGACATGGGCACTTGCAAAGCGG
CTACAGGCGTCTGAGTTGGCACAGATGCCGCAGGGGTCAGCAGCTGCCTCTGTGGTTTAG
ATCCCTGCCCACCAGTGCCATCAGA
gtaggaggtgcaggggcggattcacatccgtcaaacaggaggccacagccacactcaggc
ctcacacaggatgtcgcagaggggaaggcagcttcttaatcagcagcgggctgtggggag
cacgagcgaagaggagaggagagcatgggacatcaggtggcacgccctgagagcaggcag

 1.03 Intr +  18872  18976  105  1  0  116  115    66 0.642  13.01
gcctctagatctgagcgtggggaagccagggtgcatgggcggtcactgtgaagctggcct
ggccccggggtggcagcctactggacttggagagagaggccctgctccacctgtttgggc
cgggcctaatcgatacctgagtgccaggacagacccctgcagctccttctgtttctccag
GTCTCCAGTGGGGGCTGCAGACTAAGCAAAATGAGGCGGTTCCTGAGGCCAGGGCATGAC
CCTGTGCGGGAGAGGCTCAAGCGGGACCTGTTCCAGTTTAACAAG
gtaagttagggagagcagggaagatgacccccaggttttcggccaagcagctcaggctgg
ggctgaggcacctcttacctggattaaggtatagctcttatgtgactgcctgcagtgcct
cttgggactcagactttggaaatggggcctggttaaagggcttttatagaaaaggggaat

 1.04 Intr +  21894  21980   87  2  0   67   52   106 0.362   5.56
aaaagtaatgtattttgatcgttttgatttggacacaatcgcaacaacagtgctctccat
ttttggagaggcagcttgcccagaggtgagtggtgccgactgcccggctcgccagctgtg
tgaccttgagcaggtcacatgcctctgagataatgataatcagagccactccatccatag
AGTTGGTGTGAGGACTACATGAGTTCCTGCACGAATCGAAGGCCACGTCTGGCTGGCGGC
TGCAGTGTCCGGCAGCATCGTTCTGTG
gtgggtgtcatgtggcttgaggttgagttgggggagccttgggacaggcccagcagacag
gcggagggcaggtccagcagacaggcggagggcaggtccagcagacaggcggagggcagg
tccagcagacaggcggagggcaggtccagcagacaggcggagggcaggtccagcagacag

 1.05 Intr +  24948  25042   95  2  2  125   61    30 0.499   3.26
caaggtaaaacccgttcctagacaactgctcacagccagctcgctcccctcggccaaacc
caggcacaccccaagcagccacacccatcagggcaaacaggctgctgtgcttgcccggct
gccgcagaagcacctgcctgggccttccctgcccgtgcccaccctcctctgtccccttag
GCCCTGAACAAACAGTGTGTTCCTGACCCAGCAGCCCCTGCGGAGGGCCAGGTTGTTCTG
TATTGGCTTTCGAATGGCTGGGCCCCTGGTGTCAG
gtgacagcagccacacagggagggccaggctgccgccactgccaggaatctgagctggcc
acacccagccagtatcgggcagagtggcccggccaggcaggagtgctcccccaaggtgct
gggcagcctctgagggcctggtgcccaccactgcctccttcccaccccctgaggagtgcc

 1.06 Intr +  31454  31664  211  2  1   66   72   249 0.268  20.54
ggctggtatggtgtcggggaagatcagctcgcaggggtggccatgaggccaagggcagag
tcacaaagggacagggggtggggcctggtaaatatgggttaggctccaacactcaggtgt
ctgggaggaaccggaaaggtaccgaagccctgcttcctgctgggtcgtctggtgctgcag
CTGCAGCAGCCATGGTGGCGCGAAGGGGACAGGTCTGCAGGCCCACCCCACGTGCTTCTC
GTTGCAGACGGTGGAGCATGGCTTCCCGCACCAGCCCAGCGCCCTCGGCTACAGCCCGTC
CCTGCGCATCCTGGCCATCGGCACCCGTTCTGGAGCCATCAAGCTGTATCCTCCGTCCCC
TCGCTCCCACTCGGGCAGGGCCTTGGGGTGG
gtgagatttggggagggacatcttttccttccttgcccgtgggctgttgggataaaatga
gggactttcctgatttccagttttggacatgattttattccaaaatggggcaggtatggt
tgatggtggagcaggcacctgggcatgagtgcatccctggtgggatgcgaccctgtcctt

 1.07 Intr +  33607  33711  105  0  0   19   94   106 0.821   5.21
tcaggtcactggcctggtgccccagggccagggctgctgtgtctcctccccaccctaggc
tccatgcatgggtcctgctgcctcgggggagggcagcccctctctgtgtttgcatcattg
cacatgggccccgagggcctggcactcaaggcaggcaggggatggtgtccgaccttccag
AGCTTTCCTGAGCCTACTCCTAGCTACGGAGCCCCAGGCGTGGAGTTCATGGGGCTGCAC
CAGGAGAACAACGCTGTGACGCAGATCCACCTCCTGCCCGGCCAG
gtgagggacctggggtgggacaggaagccacttccatgccctccttgccttcactgcttc
cagcagggctggtgtggagaggctggcattcggtggccctgggtttgctgctgatggaaa
gacctgggaccccctccctttccacagctggggctcatgggccaccctgggagtggccag

 1.08 Intr +  33987  34102  116  2  2   53   86   176 0.969  13.65
gccctgggtttgctgctgatggaaagacctgggaccccctccctttccacagctggggct
catgggccaccctgggagtggccagggggtcttttaaacaactggggctgcgtggcccca
gtgtgtaaaggccttgcctgggtagcaagaccacatgatcccgtcgtgtgccctcgccag
TGCCAGCTGGTCACCCTGCTGGATGACAACAGCCTGCACCTTTGGAGCCTGAAGGTCAAG
GGCGGGGCATCGGAGCTGCAGGAGGATGAGAGCTTCACACTGCGTGGACCCCCAGG
gtaagggctcaatccccagccccttccactcccagcccagcctgacccttgcccttagct
ctggagtggactcaccctttgtgaggcctgttgcgcccctggcagtgactggcatgcgtt
tggcccgatgcatcgccacactcaggtgctccgagtggagtgggcggggctgcagcctgc

 1.09 Intr +  34161  34247   87  0  0   63   47    75 0.568   0.48
cgccagtgccagctggtcaccctgctggatgacaacagcctgcacctttggagcctgaag
gtcaagggcggggcatcggagctgcaggaggatgagagcttcacactgcgtggaccccca
gggtaagggctcaatccccagccccttccactcccagcccagcctgacccttgcccttag
CTCTGGAGTGGACTCACCCTTTGTGAGGCCTGTTGCGCCCCTGGCAGTGACTGGCATGCG
TTTGGCCCGATGCATCGCCACACTCAG
gtgctccgagtggagtgggcggggctgcagcctgcctcctccatccacaccacgcctcct
ccatccgcaccccacctcctccatccgcaccccgcctcctccatccgcaccccacctcct
ccatccacaccacgcctcctccatccgcaccccacctcctccatccgcaccccgcctcct

 1.10 Intr +  34727  34885  159  2  0   86   89   306 0.627  30.12
ggctctctgccatctgtctcctgtcttggcagaaagtgaccaatgtttgtcctggcttga
aatgttatgacctcattaaagggccttatgggcttgttttccgaggagtcaggggacccc
gtccatggcatctcccctgctgggcagtggtcggctcacgggcagctgttcttgtcacag
GGCTGCCCCCAGTGCCACACAGATCACCGTGGTCCTGCCACATTCCTCCTGCGAGCTGCT
CTACCTGGGCACCGAGAGTGGCAACGTGTTTGTGGTGCAGCTGCCAGCTTTTCGTGCGCT
GGAGGACCGGACCATCAGCTCGGACGCGGTGCTGCAGCG
gtgagcccagagcccagctgctgttaactccatcccctcaagttaggcatggcttctccc
cttggtcccaggactctgtcaggagctgtcatttctctgctgggaattccatggggctat
agcaggggaggctcttggcttcctacctgtcacctactgagaacctattggcctgtcata

 1.11 Intr +  38491  38653  163  1  1   49   96   256 0.592  22.99
ctgggattacaggcatgagccaccacgctcggccatccactgcgcccagcccctagccat
atttctatgctggcacatggagcagccacctctgcatagggagccccatggctgtgccat
gctgggggccattccccctggtggacggcatcggaggctcacggcactcccctcgcccag
GTTGCCAGAGGAGGCCCGCCACCGGCGTGTGTTCGAGATGGTGGAGGCACTGCAGGAGCA
CCCTCGAGACCCCAACCAGATCCTGATCGGCTACAGCCGAGGCCTCGTTGTCATCTGGGA
CCTACAGGGCAGCCGCGTGCTCTACCACTTCCTCAGCAGCCAG
gtaggcagtgcccaggacatggcaggcgccatgttgctctcccagggccccaagtggcac
atacacactgtgcagaggcatggggtgcaggcgatgggaacgccgcctcggtccagcgtg
ctgccctctgtccctctcctcttcctccatagcaactggagaacatctggtggcagcggg

 1.12 Intr +  38806  38991  186  0  0  121   61   184 0.615  19.40
cgtgctctaccacttcctcagcagccaggtaggcagtgcccaggacatggcaggcgccat
gttgctctcccagggccccaagtggcacatacacactgtgcagaggcatggggtgcaggc
gatgggaacgccgcctcggtccagcgtgctgccctctgtccctctcctcttcctccatag
CAACTGGAGAACATCTGGTGGCAGCGGGACGGCCGCCTGCTCGTCAGCTGTCACTCTGAC
GGCAGCTACTGCCAGTGGCCCGTGTCCAGCGAAGCCCAGCAACCAGAGCCCCTCCGCAGC
CTCGTGCCTTACGGTCAGTGTTTCACCCGCCGGGCAGGGCCCACCCCCAGTGCCTCCTGG
ATTCAG
gtgcaggttgctcaattctgaagcaaactccagggccagagagggtaaaggctttgtcca
aagccacacagcagggttcgcctcacccagtttcttggggaacttctcggagcaagattc
ccaagcacaggtctaccatgtggatgtggcatgagctagagggatctgtgcctgtgggga

 1.13 Intr +  39850  39982  133  0  1   79   13   219 0.084  14.22
ctccaagtcctcctgggctgtagcagttggaaggagatggggtccagtctcccctgctcc
tggggaccttgactgagtggtgactttgattgccggcctgtggctgttgaggctgtgcca
ggagccccagcccactgccgctcctctgtgcctgccaggttgcccttcaccatcttccag
GGTGGCATGCCACGGGCCAGCTACGGGGACCGCCACTGCATCTCAGTGATCCACGATGGC
CAGCAGACGGCCTTCGACTTCACCTCCCGTGTCATCGGCTTCACTGTCCTCACAGAGGCA
GACCCTGCAGCCA
gtaggagagcttcgggagtgggtgcccagggttaggtgtgggaggcatggggcaggacca
tcagtaaagacagggccaggtgcagtggctcctgcctgtaaccccagtgctgtgggaggc
caaggtggtaggatcgcttgaacccaggagttcaagtccagcctggacaacgtagggaga

 1.14 Intr +  43951  44168  218  2  2   90   78   378 0.999  35.75
agccagggctactgcccacacctgctgccctcctggagatggaaaggctttgctcaagca
gccaagaacagggctttctggatctgcagatgccctggctccaaccctggagcttctgat
tccacagagctgggctgcttcctcctggccccggcccctgacccttgccctgtaccccag
CCTTTGACGACCCCTATGCCCTGGTGGTGCTGGCTGAGGAGGAGCTGGTGGTGATTGACC
TGCAGACAGCAGGCTGGCCACCGGTCCAGCTGCCCTACCTGGCTTCTCTGCACTGTTCCG
CCATCACCTGCTCTCACCACGTCTCCAACATCCCGCTGAAGCTGTGGGAGCGGATCATTG
CCGCCGGCAGCCGGCAGAACGCACACTTCTCCACCATG
gtaggtctggccctggccccagccccagccccaccgcaagccaaactctcccatggactt
cttggtctctttttctaggagtggccaattgatggtggcaccagcctgaccccagcccca
ccccagagggacctgctgctcacagggtagggtactttgatgctaccccacctcttccca

 1.15 Intr +  44436  44606  171  2  0   79  100   347 0.629  35.65
attgatggtggcaccagcctgaccccagccccaccccagagggacctgctgctcacaggg
tagggtactttgatgctaccccacctcttcccagtaggatatgtggggtgggagcagagc
cctgaggtggacgagccagcccctgggcatcccggctggcatccctctcacgcctggcag
GTGGGTTCTGCCCACAGGCACGAGGACGGCACGGTGCGGTTCTGGGATGCCTCGGGTGTC
TGCCTGCGGCTGCTCTACAAACTCAGCACTGTGCGCGTGTTCCTCACCGACACGGACCCC
AACGAGAACTTCAGTGCCCAGGGCGAGGACGAGTGGCCCCCACTCCGCAAG
gtgaggccaggagcctgggacccaggaagggcagaggccagctgggtcctgtccccgtgg
ctgctcacagggcccctccccttctccaggtgggctcctttgacccctacagtgatgacc
cccggctgggcatccagaagatcttcctctgcaagtacagcggctacctggctgtggcag

 1.16 Intr +  44696  44800  105  1  0  110   69   206 0.999  21.81
actcagcactgtgcgcgtgttcctcaccgacacggaccccaacgagaacttcagtgccca
gggcgaggacgagtggcccccactccgcaaggtgaggccaggagcctgggacccaggaag
ggcagaggccagctgggtcctgtccccgtggctgctcacagggcccctccccttctccag
GTGGGCTCCTTTGACCCCTACAGTGATGACCCCCGGCTGGGCATCCAGAAGATCTTCCTC
TGCAAGTACAGCGGCTACCTGGCTGTGGCAGGCACGGCAGGGCAG
gtagcaggctgggctggggagggggagctggggaggagtggtcgatgactggggacagca
gggacaggagccaaccacctgcctaacgcacattctgtgtcctttgcttttccggtggat
ggaggtggcttgatccccttggcgggaggtccctgggatggttgtttcttctccagaaat

 1.17 Intr +  45438  45730  293  2  2   78   52   487 0.998  40.58
acagagcaagacttgtctcaaaaaaaaaaaaaaaaaatgcaggagagctggggttggaca
gaggcctttgtccttccttgagccttgggcccagctcctttgctgtccccactagtagca
tcctgcggccctgccgtccctttgctgagggcttgctgagccacctgccaccctgcgcag
GTGCTGGTACTGGAACTGAATGACGAGGCAGCGGAGCAGGCTGTGGAGCAGGTGGAGGCC
GACCTGCTGCAGGACCAAGAGGGCTACCGCTGGAAGGGGCACGAGCGCCTGGCAGCCCGC
TCAGGGCCCGTGCGCTTTGAGCCTGGCTTTCAGCCCTTCGTGTTGGTGCAGTGTCAGCCC
CCGGCTGTGGTCACCTCCTTGGCCCTGCACTCTGAGTGGCGGCTCGTGGCCTTCGGCACC
AGCCATGGCTTTGGCCTCTTTGACCACCAGCAGCGGCGGCAGGTCTTTGTTAA
gtgagcaggggcggctgggtcccggggctgggagtggggcccgcgaggactcccaggacc
tagcagcactgacagcctgccatccccccaaggtgcacactgcaccccagtgaccagctg
gccttggagggcccactctcccgcgtcaagtccctcaagaagtccttgcgtcagtcattc

 1.18 Intr +  45823  45973  151  1  1   53   78   178 0.620  13.98
tgcactctgagtggcggctcgtggccttcggcaccagccatggctttggcctctttgacc
accagcagcggcggcaggtctttgttaagtgagcaggggcggctgggtcccggggctggg
agtggggcccgcgaggactcccaggacctagcagcactgacagcctgccatccccccaag
GTGCACACTGCACCCCAGTGACCAGCTGGCCTTGGAGGGCCCACTCTCCCGCGTCAAGTC
CCTCAAGAAGTCCTTGCGTCAGTCATTCCGCCGGATGCGTCGGAGCCGGGTGTCCAGCCG
GAAGCGGCACCCGGCTGGCCCCCCAGGAGAG
gtgaggcctgaggtgaggctgcggccggccacgcacccaggttcggctcagagcagccag
caggggggccacacggcccctgctccccaggcttgctaggctacaaacaagattcagggt
ccaggtcgcattgtgtgacctcagacaggtcacgctgcttctctctgcctcagcttcctg

 1.19 Intr +  46425  46575  151  2  1   87   79   211 0.992  20.35
cccaggcaggctcccccaagggcacctccctcttggacaagggtccctctagacgcaggc
ctggcaggtggctggcatggctgtggcctgccttccgatgcaaggatcagcactgagcga
agcactgttcctggggaggggagtccagagctgacccttaggctggcccaccccttgcag
GCACAGGAGGGGAGTGCCAAGGCTGAGCGGCCAGGCCTCCAGAACATGGAGCTGGCGCCT
GTGCAGCGCAAGATCGAGGCTCGCTCGGCAGAGGACTCCTTCACAGGCTTCGTCCGGACC
CTGTACTTTGCTGACACCTACCTGAAGGACA
gtgagtggccagcctggggttggggggcagggggtagtgggcagcagacaccccctgacc
tgggggcatgccgggggctgctgcctgcctggctggtaggagctaagaggtttccccttg
tgagcaggggcagactgcagcccctgcctgcttactcccctcccctgcctcagcctctga

 1.20 Intr +  47142  47258  117  1  0   32   96   122 0.853   8.34
tgtatcacagcaagggctgagctgacctgggattggggtcttctatgttggggcctgtgt
ggttgtcagagagccttccagcctctcccaggagggaaaacctgggagtaaaccctggtt
gcccagctccacccgactcccacgctaagggtcagacacccaaacatggcttctcggcag
GCTCCCGGCACTGCCCCTCGCTGTGGGCTGGCACCAATGGGGGCACCATCTATGCCTTCT
CCCTGCGTGTGCCTCCCGCCGAGCGGAGAATGGATGAGCCTGTGCGGGCAGAGCAGG
gtgagtgctgggcagggagagcagagggtgctcgggctgcctgggctgggtccagggagt
ggctccagccctgccaccccctcaccagccccaacacccacctcctccccctagccaagg
agatccagctgatgcaccgggcgccggtggtgggcatcctggtgctcgacggacacagcg

 1.21 Intr +  47373  47539  167  1  2  101   45   234 0.947  20.59
atgccttctccctgcgtgtgcctcccgccgagcggagaatggatgagcctgtgcgggcag
agcagggtgagtgctgggcagggagagcagagggtgctcgggctgcctgggctgggtcca
gggagtggctccagccctgccaccccctcaccagccccaacacccacctcctccccctag
CCAAGGAGATCCAGCTGATGCACCGGGCGCCGGTGGTGGGCATCCTGGTGCTCGACGGAC
ACAGCGTACCCCTTCCCGAGCCCCTCGAAGTGGCCCATGATCTGTCGAAGAGCCCTGACA
TGCAGGGAAGCCACCAGCTGCTCGTCGTATCAGAGGAGCAGTTCAAG
gtgccacacgggcagcggcgggtctccctgggactccccgggacatccaggaggctcgga
ccttgggcaaaaatgatggctgggactcagtcttgtttgcagttggtgtctgaggggctg
cagaagtacaggaaataagtgaggggggagtctcgtgtgaggacactgaggcaggacagg

 1.22 Intr +  48489  48753  265  2  1   67   32   537 0.989  43.62
aaaatccagatagggaagtcggtgacctcggcatcctcccaggccatgtctgtgcatctg
agagccaagggtttgtcaggacaccgggaggcatgtggggaggggagggcccagcagcag
cagcacagggcaggagaactggtttggccatgggcatgaacaaccaccccacgcccccag
GTGTTCACGCTGCCCAAGGTGAGTGCCAAGCTGAAGTTGAAGCTGACGGCCCTGGAGGGC
TCAAGAGTGCGGCGGGTCAGCGTGGCCCACTTCGGCAGTCGTCGAGCCGAGGACTACGGG
GAGCACCACCTGGCAGTCCTTACCAACCTGGGCGACATCCAGGTGGTCTCGCTGCCCCTG
CTCAAGCCCCAGGTGCGCTACAGCTGCATCCGCCGGGAGGACGTCAGTGGCATCGCCTCC
TGCGTCTTCACCAAATATGGCCAAG
gtgtttgagccgggctgggtgggtgtcggggccccgggcactgcacggacgggaagggtg
gccaggggtgttgtggccacggccagactggatgggccttaagcggagaactgcgaggga
gcactagcccctactcccccaggtggggaggcagccttggcagccgccaggccaggccgc

 1.23 Intr +  48956  49106  151  0  1   59  109   181 0.998  17.03
gtgtcggggccccgggcactgcacggacgggaagggtggccaggggtgttgtggccacgg
ccagactggatgggccttaagcggagaactgcgagggagcactagcccctactcccccag
gtggggaggcagccttggcagccgccaggccaggccgctagcattgcccccactccccag
GCTTCTACCTGATCTCACCCTCGGAGTTTGAGCGCTTCTCTCTCTCCACCAAGTGGCTGG
TGGAGCCCCGGTGTCTGGTGGATTCAGCAGAAACCAAGAACCACCGCCCTGGTAACGGTG
CGGGCCCCAAGAAGGCCCCGAGCCGAGCCAG
gtgagtgaaagggccagaggcctctcccgcccctcccgcccctccctgccctctctgaga
taccgaggctcccactgctgcctggctggaggcacctccccacgagctcagcccaccctc
ccaggctccggctctccttgcctctttgcgtgccccttgcccctgtgcaagctggcagtc

 1.24 Intr +  49427  49455   29  2  2  129   90    21 0.981   4.64
cctctttgcgtgccccttgcccctgtgcaagctggcagtccagggcaggactcagtttac
ctcccaggctctccggctcaggacaggctgcgccattgacttgttcttcatgggaccagg
gctctcagagccgggcagggagcccgggggccctggtcctcactgtctcttcccccacag
GAACTCAGGGACTCAGAGTGATGGCGAGG
gtaagacaggcctcctgggctcatgcacacctgggccacacccggcccagacctggggct
ggacgggagggaagggtcccgagtgagcaggtagtgtttgggctgggaatagagacggca
ttccttccagccctgggccctgggcttccacatcctgacctcagtaaggagagagagagc

 1.25 Intr +  49688  49735   48  0  0   93   70    57 0.813   3.54
ctggggctggacgggagggaagggtcccgagtgagcaggtagtgtttgggctgggaatag
agacggcattccttccagccctgggccctgggcttccacatcctgacctcagtaaggaga
gagagagccaggccgaggagggcccaggcggggcgccctgacccggcctctaccttccag
AGAAGCAGCCCGGCCTGGTGATGGAGCGCGCTCTGCTCAGTGATGAGA
gtgagttgggtgggagagggtggggctggcaggaggggtggggaaggggggtcagggtca
agggaggctgggcaggccactgccctgaggcggggtacagatccatgggcacccacggag
aaagggggtggaagggctgtggctagccgccccaagggcctcagtgggcctctgttccca

 1.26 Term +  50085  50317  233  1  2  110   39   116 0.885   5.87
ctctgttcccacccggcctgcaggagtcctgaaggaaatccagagcacactggagggaga
ccgcgggtgaggcaccgcccaggccagctggggtgggcccgaggctctgccagagggctc
aggggagcgctgagagtggaggtccctgaggccatgactcccctgtctttgcctgtgcag
GAGCGGCAACTGGCGTTCACATCGAGCCGCCGTGGGGTGCAGCCTCAGCAATGGCGGAGG
TGGGGGCTCTGGGCTTGAGTGCAGCTGCCAACCGTGCTGGGAAGGGCTGGGAGGAAGAGC
CCCGGCCCCACTCCCCTGGGTCCCACGGGGCTGACACGTGCCCTGATGACCAGGAAAGCA
CCATGTCTGGGCTCAGCGTGGGCGGCTGGGGCACCCCGTCCTGCCCAGGGTGA
tcttgagctgtccctctgtgtccttcagcagagtgagtggctgagcgtccaggctgcgcg
atgagcacacactactactgatggcctttcgggggtccctgccccaaccggagaggccgg
tgcacagggccccgccaggggctgggggcatcccggcttccacaatgcagctgctctggg

Predicted peptide sequence(s):


>LLGL2_1|GENSCAN_predicted_peptide_1|1357_aa
XPPADTEEVGAPPHPPPRKGVSPRRPGPYTIPLVGLETRPCVPRSPSLGWALAEELARIR
PSLGSSRELEGRLPWSLGGGPGPQAFRELFPLAGGGGTLGAARRSASRSHSMELPFSQGL
VAKLLARDLPGASGRLGFPGRHGHLQSGYRRLSWHRCRRGQQLPLWFRSLPTSAIRVSSG
GCRLSKMRRFLRPGHDPVRERLKRDLFQFNKSWCEDYMSSCTNRRPRLAGGCSVRQHRSV
ALNKQCVPDPAAPAEGQVVLYWLSNGWAPGVSCSSHGGAKGTGLQAHPTCFSLQTVEHGF
PHQPSALGYSPSLRILAIGTRSGAIKLYPPSPRSHSGRALGWSFPEPTPSYGAPGVEFMG
LHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGSGVD
SPFVRPVAPLAVTGMRLARCIATLRAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLP
AFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQ
GSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGQCF
TRRAGPTPSASWIQGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATF
DDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAA
GSRQNAHFSTMVGSAHRHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGE
DEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQ
VEADLLQDQEGYRWKGHERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVA
FGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSS
RKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLK
DSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDG
HSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVR
RVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIASCVFT
KYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQ
SDGEEKQPGLVMERALLSDERAATGVHIEPPWGAASAMAEVGALGLSAAANRAGKGWEEE
PRPHSPGSHGADTCPDDQESTMSGLSVGGWGTPSCPG