GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:34:52

Sequence LASP1_1 : 54047 bp : 53.82% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    462    606  145  1  1   89   50   157 0.985  11.85
tttttttttttttttttagtcaggacccaatgttaaaatgtgagtcaagaatgaaaaaca
gatggttaacaaggggaaggaaaaaccaagccattgagggggcacccggatttgaaccag
ggacctcttgatctgcagtcaaatgctctaccactgagctatacccccgcgcctctacag
CGCCTGGAGGCGGCTCCTTGGGTGCTAAGCATTGTTGCAGCTGCTACACTGTGAGTAGTG
GTGTAACAGAAGGAGAAAGGAATGCTGGAGAAAAAGGGGTCAAGCTGAACGCAGACGGTG
CCCGCATCCGGGGAACCCCGGGAAG
gtgcactgcaggggctcgagagggaagcactagcccgggcccggcagcgcgcagggtcca
agagggagggacgggttccgccccacaaatgtgggaaagggtgtgggccggaagagagct
aagaggggcagggtagggggtccccgttcggtccgcagattcatgccgggtagaaagtcc

 1.02 Intr +   1122   1344  223  0  1   80  105   148 0.948  14.36
ggcgcagtcagcctgagagcgctgaggcgccagcaccgcgggccccgccgtccccccagg
aacccgcccccgcgcagccccacgtcgcccggagagcgcgcctcgctgcgcgtgcccttg
cccgcgcccgaggcgcgtgcccgccccagtgcagcccctcctccccgctgtgtttattag
GGGAAGGAGGGCGGAGGCGGAGGCCAGTTCCCCAGCTCCAGCCGCCGTCGCTGCTGCCTG
TGTAGTTGCAGCCGCGGCCGCCTCCCGCCAGCTCGCCTCGGGGAACAGGACGCGCGTGAG
CTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGG
CAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAG
gtgagcccgggaccgggagacgcgtctttgcaatcccccgcagtgctccgaatccaggga
ggagagaagggccgggtctttgccgccttatccccgcgatcccaggagaatggagggagg
gcgagcgggcggtgtcatggggtgtggggacacatcccagtctgaaaaccaggagatctg

 1.03 Intr +   9172   9266   95  0  2   94   77   211 0.613  19.86
ggggagtgccaaagcctgtgacctgaaatgcccccagctcacctgggatgattccatgtt
ctccccacagccatgggcctaggacagtcccagcagctcctgagtgccccttcctagggc
ctgagcccctttttcagaagtcctggtatctgatgtatgtcctcctgtctccatccccag
TTCTGGCATAAAGCATGCTTCCATTGCGAGACCTGCAAGATGACACTGAACATGAAGAAC
TACAAGGGCTACGAGAAGAAGCCCTACTGCAACGC
gtgagtcctgttctgggcagggggctgggtgggcaccttggctccctccccgagtgagtt
cttcctttccttccaataaccgcaaggtgacattggcgaacacttccatcccctacttga
acatcacagtttgtcctcacaacagctgaatgaagcaagcactttttatccccatttaaa

 1.04 Intr +  18610  18807  198  1  0   68  100    82 0.551   6.39
tagggcctcagggcctgccagccctgctagagatcttccctttctggtctctaggaacag
actcgtggttgatcatcccttggcctggaattgtacaggaactttgaagggagctcctca
gctgtgggtggccctggctgcacggggacgaccccagacttggccacgtattcatcacag
GCCACGTCTGTTGCCAGCTGCGGACACCTGTGTTTGCCTTTCCTCATCTTCCCTTCCTCT
GCTGGAGGAACTGCGAGTCTGGGCTGACCTGGGTGGCCAGGACCCAGGTGAGGGCTGGGG
GACGGGCACCGCTAGGATCATCTGGATCCGGGACAGTGAAACTGGCCCAAGGGAAAAAGG
ATTTGCCAAGGTCACCCA
gtaagtcagtggcagggccagagccctgcactgggccctgtcaagttatgctcctttgat
tgaggtctccaaatcctgagccctgcccttcacaagtggtggcctcaggggaagtcgcct
gtttacaggtagctctgatgcacggccatgtgggcggcaggagaacatgccgagcagagg

 1.05 Intr +  21506  21590   85  2  1  125   94   104 0.970  15.02
tctgagaaacgcttgtctcccctcggccttggtggtggacactgaagtcctcctgtgggg
ccgggccagggcgtgcccaagcataggacgaagttcccaggagggcatgctctgtgagaa
gcccagaggctcctgcccctcccccagagtcacccccactctgttttttctgtcctgcag
ACACTACCCCAAGCAGTCCTTCACCATGGTGGCGGACACCCCGGAAAACCTTCGCCTCAA
GCAACAGAGTGAGCTCCAGAGTCAG
gtgaggggctgggcggtgctggggcctggcagggagggatgctggggagggaagttgtaa
ggtcggcatttggcaagagtaccttcccctgcggttactctgcaaggccaaggtgctgaa
atcctagcattgcctttaatcttgaccccacccctgactttatcaaaggagcagggtaga

 1.06 Intr +  24154  24354  201  0  0   74    0   155 0.089   5.30
tcttgggagatgaaaatggcggtcactcttcattagggcctcactgagggccagagcgtg
tccgtgtgtgtatgtgtgtgtgtgtgcgtgtgcacgcatgcacgcgtgtatgtgtgtgtg
tgtgtgtgcaagcatgcacgcatgtatgcgtgtatgcctgactttgtttaatccttacag
CCACCTGATGAAAGAGGGGCTCTTATTATCCCCATCATACAGATAGGGAAACTGAGGTTT
ACAGAGGCTGCCCTGCTTGTGCAGAGCCCAGGGACAGGGGCAGACATCAAGTCCCATGAC
CTGGCCCTGGAGCCCGTTGCTCTGAACAGTGCTGATGGCACAGGCACCGAGCCCTGTGCT
CCCACCCTGCAGGATGCACCA
gtcagcagcaagtaggatgggcttgttggaatgcagattcctaggccccacccaagggac
ttctgcttggcagctctgggtgaggcccaagaatctgcattttgactcccccgtgattct
gataaggacttttggccccactttaagaagcttagagatgggtccatgggcaggagtgta

 1.07 Intr +  29498  29605  108  1  0  153   66   199 0.899  25.18
tattacgagtctaacaccttttggctgaggcctctgctttgagttggggacttctgatca
gggtctttctgctgactccctgtccctgtctcctgactggttgctgcctcagaggggccc
caagccgaggccctttcggctcctggcctgactccaatccctcttcctcccctcctgcag
GTGCGCTACAAGGAGGAGTTTGAGAAGAACAAGGGCAAAGGTTTCAGCGTAGTGGCAGAC
ACGCCCGAGCTCCAGAGAATCAAGAAGACCCAGGACCAGATCAGTAAC
gtgagctcttgccctgccctgcggcatccctgctgccctctgtttggtccccttcctgcc
agcctggcagacgcaagcctggcagatgtgaatgaggccagtgcctccactacccctgcc
ctccagggtgggcctggggaagagcttggggttcccagatgcctcttctctgtgtacccc

 1.08 Intr +  39823  39876   54  0  0  106   37    48 0.060   1.16
aacaggcttagcctgtgctgccacgtgggtgccggtccttgctctggcctgaagggaggg
ggccgggaaaggagggactgatcctgacccaaacccctaagtaaactgccctctgcgtcc
agactggactccccccagactctgtccaggcccttaccactgccctccctgtgcccccag
CCCGGGCTGCAGGAACTATTGGCTGTTCAGCCAGCAGGAGCAGCAACCATGCAG
gtgtttccagctgttaacgtgtaagccctgcctggccacgtgcttgctcttgccttttgt
gcacagccagtgccaagggggagaggaggcagcagagacgttgtgcggaggggatgccca
aaggggactgcccaggctgggacagccctgatggggcaggggcgttccaggaaacagcag

 1.09 Intr +  45411  45561  151  2  1  100  100   256 0.997  28.25
ggcttggcaagattaggtagcttgtccaaggacacacagctggtgcttccagagcgagac
ctggctttctgtacccaaagctcttgggtagtctctcccatcctgggatcttgagggtca
cgggaaggaactgggtggtttgcagtgggacccttcacctagtgccttctgaccttgcag
ATAAAATACCATGAGGAGTTTGAGAAGAGCCGCATGGGCCCTAGCGGGGGCGAGGGCATG
GAGCCAGAGCGTCGGGATTCACAGGACGGCAGCAGCTACCGGCGGCCCCTGGAGCAGCAG
CAGCCTCACCACATCCCGACCAGTGCCCCGG
gtgagtgcaggtcctgttggtgcagatgacctgaggcgaggccagtggggtggggaggaa
gccaggagaagacagacagacagatacaccttccggagccttgctcttaatcaacaggcg
attatgcctcttgtgtgcaagaggggaccagaggacctgaggccgggccagctggggtgg

 1.10 Intr +  46129  46232  104  2  2   78   84   157 0.979  14.69
cccctgcgtgggatacaacacacaggcaaatgtgcacacgtggacatcagcctttgagct
gtggggcttgagccaggttgggggcggggtggaagtgcatggtatggacttctcgggagc
tctgggaggggctgggtttggcaggacagtttccaagccctgtctcctcccatcttccag
TTTACCAGCAGCCCCAGCAGCAGCCGGTGGCCCAGTCCTATGGTGGCTACAAGGAGCCTG
CAGCCCCAGTCTCCATACAGCGCAGCGCCCCAGGTGGTGGCGGG
gtgagtaaccctggccggaggggagaggccagaggcagggggtccttcgggaaggcttgg
acacagctcatggattctcctgacctttgcacccaccctctgttgtgtgtgatgataagg
atctcagccttgtgagcagagaggaaattggttggcgtagtgggcagaggctggctggga

 1.11 Intr +  49597  49644   48  0  0   86   99    17 0.598   1.96
tgcagtcctgttcagggaggtggggcagagctgatgtgacccggtccctgctctgcctct
ggcccttagtagctgccaaaggttgtaaaagatcgattgctctcagaaagcaagacacag
aggttaagaatctttgcagcagagcctggtgctccatttctgagttcactgctcccccag
GCTCTGCTCCAGGGTCGTGGAGAGTTAGAAAAAAATGCTCAGACCCAG
gtgagccggcatgcagggccctaggctgaccacacttcccccacagaagcggtaccgcgc
ggtgtatgactacagcgccgccgacgaggacgaggtctccttccaggacggggacaccat
cgtcaacgtgcagcagatcgacgacggctggatgtacgggacggtggagcgcaccggcga

 1.12 Term +  49691  49864  174  1  0   77   46   573 0.978  50.08
gattgctctcagaaagcaagacacagaggttaagaatctttgcagcagagcctggtgctc
catttctgagttcactgctcccccaggctctgctccagggtcgtggagagttagaaaaaa
atgctcagacccaggtgagccggcatgcagggccctaggctgaccacacttcccccacag
AAGCGGTACCGCGCGGTGTATGACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAG
GACGGGGACACCATCGTCAACGTGCAGCAGATCGACGACGGCTGGATGTACGGGACGGTG
GAGCGCACCGGCGACACGGGGATGCTGCCGGCCAACTACGTGGAGGCCATCTGA
acccgcagcgcccccatctgtcttcagcacattccacggcatcgcatccgtcctgggcgt
gacccgtccattcttcagtgtctctgttttttaaaacctgcgacagcttgtgattcctac
ccctcttccagcttcttttgccaactgaagccttcttctgccacttctgcgggctccctc

Predicted peptide sequence(s):


>LASP1_1|GENSCAN_predicted_peptide_1|528_aa
XPGGGSLGAKHCCSCYTVSSGVTEGERNAGEKGVKLNADGARIRGTPGRGRRAEAEASSP
APAAVAAACVVAAAAASRQLASGNRTRVSSGVPAPAFLGTMNPNCARCGKIVYPTEKVNC
LDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAPRLLPAADTCVCLSSSSLPLLEELR
VWADLGGQDPGEGWGTGTARIIWIRDSETGPREKGFAKVTQHYPKQSFTMVADTPENLRL
KQQSELQSQPPDERGALIIPIIQIGKLRFTEAALLVQSPGTGADIKSHDLALEPVALNSA
DGTGTEPCAPTLQDAPVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNPGLQELLA
VQPAGAATMQIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAP
VYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGALLQGRGELEKNAQTQKRYRAVYDY
SAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI