GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:44:31

Sequence KRT12_1 : 8307 bp : 42.10% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1225   1791  567  0  0   79  116   438 0.913  38.81
ttttcattatacataaatcattcacttgttgagctggccaaaaacctggggggaggatcc
aattttgagtggagaaagtgaacttttcaactgcgacacccatcttgcagcctatataag
tttagctttctggcttgctggcacaacttcctctccagttgtggccaccttccccaggcc
ATGGATCTCTCCAACAACACCATGTCACTCTCAGTGCGCACCCCCGGACTGTCCCGGCGG
CTCTCCTCGCAGAGTGTGATAGGCAGACCCAGGGGCATGTCTGCTTCCAGTGTTGGAAGT
GGTTATGGGGGAAGTGCCTTTGGCTTTGGAGCCAGCTGTGGGGGAGGCTTTTCTGCTGCT
TCCATGTTTGGTTCTAGTTCCGGCTTTGGGGGTGGCTCCGGAAGTTCCATGGCAGGAGGA
CTGGGTGCTGGTTATGGGAGAGCCCTGGGTGGAGGTAGCTTTGGAGGGCTGGGGATGGGA
TTTGGGGGCAGCCCAGGAGGTGGCTCTCTAGGTATTCTCTCGGGCAATGATGGAGGCCTT
CTTTCTGGATCAGAAAAAGAAACTATGCAAAATCTTAATGATAGATTAGCTTCCTACCTG
GATAAGGTGCGAGCTCTAGAAGAGGCTAATACTGAGCTAGAAAATAAAATTCGAGAATGG
TATGAAACACGAGGAACTGGGACTGCAGATGCTTCACAGAGCGATTACAGCAAATATTAT
CCACTGATTGAAGACCTCAGGAATAAG
gtaagatctcttttggaggcgctttgggaattttttttttcctttttaccattacaatgt
tttacagtgataatcacctacaactttgatattttccaatttagctgtacttgcagcaat
tttctcatcccaggttgtttcactccactttatcatttactaagaaatgattgtatttcc

 1.02 Intr +   2174   2256   83  1  2   88   81    69 0.995   3.72
gcatttctttacttctcaatattattttatacagatattgtcttagaaaaatgaaactgt
cttaaactctaaataaaacagcatttaatatcaccattttcacctttgtgtcaaaaatat
atttgtataatactagtcttttagggcttcaatcttgtgtgtgtccctctcttttgccag
ATCATTTCAGCCAGCATTGGAAATGCCCAGCTCCTCTTGCAGATTGACAATGCGAGACTA
GCTGCTGAGGACTTCAGGATGAA
gtgagtcgaataaactgaagatcatgggcgtgtcccaccatgtcttctgtcctactgtcc
tgccttcattgatataaaatcttctgaagttcacatactccatatatttactgttttggt
aaattcacatagggtgttctagaaagtaattagaatctaatgcaattcagattaaatgtc

 1.03 Intr +   3449   3605  157  2  1  100   76   318 0.996  30.89
agtaaacaatggtgggaaaaaaggaaaggaaaaacacaacagcaaaaactgcatcataca
ctacaatgctgccattattaagtaggtgcacagatttaagcaagaaatagccctgaagat
cagtggccttgttcaaatggttgtgttgattccctcaactgctttgcacttggttttcag
GTATGAGAATGAACTGGCCCTGCGCCAGGGCGTAGAGGCCGACATCAATGGCCTGCGCCG
GGTGCTGGACGAGCTGACCCTGACCAGGACCGACCTGGAGATGCAGATCGAGAGCCTGAA
CGAGGAGCTGGCCTACATGAAGAAGAACCACGAGGAT
gtgagtcagacagggcagcctcactcagctacttttttttttctcccagacccaaaaatt
acaatttcaaatttagaaatctggagtcaggacaagtatggagaatacattgtctccctg
ttaaaatggccatttgttttagatttctgtgtgatgtgtgtggtatgtgtgtgtgtgatg

 1.04 Intr +   4460   4708  249  1  0   62   87   315 0.733  25.51
gtaatttcagggacccatgaatatgtcttaagttcttgtaatatcagaagaaaaatatga
attttgaggttaaaaaagttttaatgtattacattaatatatttgtctttataccaacag
tcataagatagaatttttaagtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtag
GAAGGGGCCCAAGAGGACAAAAGTATCCAGGGCCCACGAAAGTCACAATGGACCCCTGTG
CCCCTCTCTCTCACATGCTGTCCCCAGGAGCTCCAAAGCTTCCGGGTGGGCGGCCCAGGC
GAGGTCAGCGTAGAAATGGACGCTGCCCCCGGAGTGGACCTCACCAGGCTCCTCAATGAT
ATGCGGGCGCAGTATGAAACCATCGCTGAGCAGAATCGGAAGGACGCTGAAGCCTGGTTC
ATTGAAAAG
gtaacacaaacaacaaaggctttgatacattcacagaaaggcctgcgaacgagctcagcg
ctcgagccccctggctgtctttgctgttgcagagcggggagctccgtaaggagattagca
ccaacaccgagcagcttcagtccagcaagagcgaggtcaccgacctgcgtcgcgcctttc

 1.05 Intr +   4801   4926  126  0  0   92   66   113 0.995   9.46
caccaggctcctcaatgatatgcgggcgcagtatgaaaccatcgctgagcagaatcggaa
ggacgctgaagcctggttcattgaaaaggtaacacaaacaacaaaggctttgatacattc
acagaaaggcctgcgaacgagctcagcgctcgagccccctggctgtctttgctgttgcag
AGCGGGGAGCTCCGTAAGGAGATTAGCACCAACACCGAGCAGCTTCAGTCCAGCAAGAGC
GAGGTCACCGACCTGCGTCGCGCCTTTCAGAACCTGGAGATCGAGCTACAGTCCCAGCTC
GCCATG
gtaggctcgtgcgcaaacagacgtagcatcctttggacttccaaagaaaatgctgcatcc
aaattacattagccgttggctaccctcctcttttcggtcccctccatcgttatttctatg
ccatttccctcccacgtgcagaagaaatccctggaggactccttggccgaagccgagggc

 1.06 Intr +   5068   5288  221  0  2   58   84   337 0.985  26.48
cagaacctggagatcgagctacagtcccagctcgccatggtaggctcgtgcgcaaacaga
cgtagcatcctttggacttccaaagaaaatgctgcatccaaattacattagccgttggct
accctcctcttttcggtcccctccatcgttatttctatgccatttccctcccacgtgcag
AAGAAATCCCTGGAGGACTCCTTGGCCGAAGCCGAGGGCGATTACTGCGCGCAGCTGTCC
CAGGTGCAGCAGCTCATCAGCAACCTGGAGGCACAGCTGCTCCAGGTGCGCGCGGACGCA
GAGCGCCAGAACGTGGACCACCAGCGGCTGCTGAATGTCAAGGCCCGCCTGGAGCTGGAG
ATTGAGACCTACCGCCGCCTGCTGGACGGGGAGGCCCAAGG
gtgagcagacaacggaggctgtaaacaccttcaggggctgaccaagagtgggcagcagaa
atagaaggaatggggttttagttgacagaaaagcaaacaaacaaacacaagtctagtaaa
gatatgcctgggatttactaaatgctctacactttgcaaagtgttttcacccattatctt

 1.07 Intr +   5776   5846   71  1  2  102   91    56 0.902   5.21
aggacacatagtagccacctgaaccacctactctaacaagctttccaaaagtgatcagag
tctgcactagttggaagaactcaggcctacaaattgggaaatctaatttctcagaccaga
tcttccattaaaagccaggttgtttcactttttgaggtcatctcctttgttttcttacag
TGATGGTTTGGAGGAAAGTTTATTTGTGACAGACTCCAAATCACAAGCACAGTCAACTGA
TTCCTCTAAAG
gtatgcagaaaccctagaatcacttagaataagtcggaatcacatttattaatgcaaaac
ctgtaagacctcattgactactgcattattattaattttaatttaaagcatatttatatt
ctgagccaaggaaaaacatttatgcattcctgcacaaaatgagtagtctataccatatta

 1.08 Term +   6653   6750   98  0  2   80   38    88 0.803   0.15
gaatacatttcattgtcattggctaaaacacatttttgagaagtaaaatttacttttgaa
agtttaattagatggattgtatcaaccaatgcttaatttagaagcctacattaaacaacc
agtgttggattaatatttgaaacactaactcttgcccccttattccatttttatctttag
ACCCAACCAAAACCCGAAAAATCAAGACAGTTGTGCAGGAGATGGTGAATGGTGAGGTGG
TCTCATCTCAAGTTCAGGAAATTGAAGAACTAATGTAA
aatttcacaagatctgccccatgattggttccttaggaacaagaaatttacaagtagaaa
ttattcctttcagagtaacatgctgtattacttcaatccctatttttgtctgttccattt
tctttggattccctattcacattgaatcctttttgcccttctgaaacaatattcagtcac

Predicted peptide sequence(s):


>KRT12_1|GENSCAN_predicted_peptide_1|523_aa
MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFGASCGGGFSAA
SMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGL
LSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYY
PLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLD
ELTLTRTDLEMQIESLNEELAYMKKNHEDEGAQEDKSIQGPRKSQWTPVPLSLTCCPQEL
QSFRVGGPGEVSVEMDAAPGVDLTRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEI
STNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLI
SNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDS
KSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM