GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:23:18

Sequence ITGB4_1 : 38782 bp : 58.35% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   4469   4547   79  1  1   56   92    93 0.649   5.83
cggaaaaggcaggagtccgaggcccagggccctgcctctggcggctgggcgcccttggtc
acattgttggtgctcagagcctcagttcccacagctgtgcagcgagaggaagctgacggc
accgaccatggctgtggaggcctcatgtgtcaattgttgctgttctgcaggaggaagagg
ATGGCAGGGCCACGCCCCAGCCCATGGGCCAGGCTGCTCCTGGCAGCCTTGATCAGCGTC
AGCCTCTCTGGGACCTTGG
gtgagtccacgttgccctgcagccccctcctggcaggatcatcccttgggcaggcattgc
ccttgcacggggatctcacggtgtctcacctaaacacgcttggccattcagcaactgacc
actgcccaccttcagggctggaaaacttgaggctccaagctcttcagcctagagaagctt

 1.02 Intr +   6960   7042   83  1  2   88   78   154 0.817  14.91
gtgagccaggatcacgccactgcactccagcctgggcaacagagcgagactctgtctcaa
aataaataaataaataacataaggagggaatccccatctctccaggtgaaggtgcaggtg
ggaaagtgcttgcctttgctgagcgcctccccattcatgtgcccacatctgtccccccag
CAAACCGCTGCAAGAAGGCCCCAGTGAAGAGCTGCACGGAGTGTGTCCGTGTGGATAAGG
ACTGCGCCTACTGCACAGACGAG
gtgaggacctggcccgggttggtgtggaacaggcaagggtcgggaatagctggtggaaat
gaatctagggttggggcagccagggaatgggtgctgccccccagtgaccccctgtccttc
tggccagatgttcagggaccggcgctgcaacacccaggcggagctgctggccgcgggctg

 1.03 Intr +   7170   7292  123  2  0  103   23   192 0.509  16.16
gctgcacggagtgtgtccgtgtggataaggactgcgcctactgcacagacgaggtgagga
cctggcccgggttggtgtggaacaggcaagggtcgggaatagctggtggaaatgaatcta
gggttggggcagccagggaatgggtgctgccccccagtgaccccctgtccttctggccag
ATGTTCAGGGACCGGCGCTGCAACACCCAGGCGGAGCTGCTGGCCGCGGGCTGCCAGCGG
GAGAGCATCGTGGTCATGGAGAGCAGCTTCCAAATCACAGAGGTGCCTGGTGTGGGGACT
GGG
gtgggggctccccatgctcagcctggctatttatgggggtgtatagtgccccttggccgg
gctgggcccccatcgggcctccggagtgaccctctagccagctgtccccttccactggct
gcaggagacccagattgacaccaccctgcggcgcagccagatgtccccccaaggcctgcg

 1.04 Intr +   7417   7621  205  0  1   80   55   375 0.988  33.39
tcgtggtcatggagagcagcttccaaatcacagaggtgcctggtgtggggactggggtgg
gggctccccatgctcagcctggctatttatgggggtgtatagtgccccttggccgggctg
ggcccccatcgggcctccggagtgaccctctagccagctgtccccttccactggctgcag
GAGACCCAGATTGACACCACCCTGCGGCGCAGCCAGATGTCCCCCCAAGGCCTGCGGGTC
CGTCTGCGGCCCGGTGAGGAGCGGCATTTTGAGCTGGAGGTGTTTGAGCCACTGGAGAGC
CCCGTGGACCTGTACATCCTCATGGACTTCTCCAACTCCATGTCCGATGATCTGGACAAC
CTCAAGAAGATGGGGCAGAACCTGG
gtacggcagggccagagtggaggacagcagggcaggagggggacaggtgggcgtctgctt
gggaggccaggactcaggacagctgcacccacccagaaggaaacactggacatttgagcc
cccaaaaaccttcccttccattctcaagggaagaatctcggtcagaccctactcaccact

 1.05 Intr +   8143   8239   97  2  1   64  100   197 0.999  18.73
cagtcccatttccctcatccataaataggaacagacaatgttgtgagcatgaacctttgt
ccagcatgcaaagcgttaacctccctcttcctcccttctgagccagcccttggtgggggg
cccgtgtttatgccaggcatcagggctcagctatcccctctctgtccttttgacatccag
CTCGGGTCCTGAGCCAGCTCACCAGCGACTACACTATTGGATTTGGCAAGTTTGTGGACA
AAGTCAGCGTCCCGCAGACGGACATGAGGCCTGAGAA
gtaagtgactgtgtgggtcccgcaggtgggcaagggtccaggccatgtgacccccactcc
tctttcacccacaacttaaaattatccttctacggctgggcacggtggctcatgcctgta
atcccagcactttgggagaccagggcgggcagatcacctgaggtcagaagttcaagacca

 1.06 Intr +   9031   9202  172  1  1  105   64   303 0.954  30.74
gaggcagaggttgcagtgagccaagatcgtgcataccgcacaccagcctgggtgataaag
cgagacttggtctcaaaaaaaaaaaaaaaaattctccttctagttgaaacgagccagggg
cactggggtctgcggcgtcttccccctgtgacactctctctccctcccacctctgcccag
GCTGAAGGAGCCCTGGCCCAACAGTGACCCCCCCTTCTCCTTCAAGAACGTCATCAGCCT
GACAGAAGATGTGGATGAGTTCCGGAATAAACTGCAGGGAGAGCGGATCTCAGGCAACCT
GGATGCTCCTGAGGGCGGCTTCGATGCCATCCTGCAGACAGCTGTGTGCACG
gtgggcactgggaagggtgctgccagcctaggccaggggtgagcacttctgggcaagggc
ctgagctgccccctggcctgctctggtgccaggctcacaggccctgagggaaagcctggg
agcctgcaaccccttcaccctgagacaagctcagactctgtgagtaggtctcagttacaa

 1.07 Intr +  10007  10270  264  1  0   88   64   538 0.971  50.36
ctcagcgttgtcactcagtcatgtgccgtcagatgcatctttcatgagggcacttgctgt
gaatccagtggcttaagcccagccccatgttgggacccgcgttccccgtcctacacgacg
ccgtgatgcgtgtcagcaggcagcctgctcagtgggcacgccccgccttgccttccccag
AGGGACATTGGCTGGCGCCCGGACAGCACCCACCTGCTGGTCTTCTCCACCGAGTCAGCC
TTCCACTATGAGGCTGATGGCGCCAACGTGCTGGCTGGCATCATGAGCCGCAACGATGAA
CGGTGCCACCTGGACACCACGGGCACCTACACCCAGTACAGGACACAGGACTACCCGTCG
GTGCCCACCCTGGTGCGCCTGCTCGCCAAGCACAACATCATCCCCATCTTTGCTGTCACC
AACTACTCCTATAGCTACTACGAG
gtgcggggcccaggtcccacgggtgggaggtggtcaaggtagggggtccatggagcttct
cagacacctctccctccctccctccctccctccctcccttcctcccttcctccctccctc
ttttcctccctttccttcctcccttcccaaagcctttagaccccccaaaatgtgggccct

 1.08 Intr +  10641  10730   90  2  0   91   54   159 0.913  14.15
ggaggtcatgtgcccatcttccaccccaactcccaagcaggtgggggctaagagggcagg
ctctgcgacaccacagtaggttccaggcctcagtttccccatcctcaaagtgggaagaat
cctagagctgttcagattcatggagatgcttagcctgagacctggccttctctcccgcag
AAGCTTCACACCTATTTCCCTGTCTCCTCACTGGGGGTGCTGCAGGAGGACTCGTCCAAC
ATCGTGGAGCTGCTGGAGGAGGCCTTCAAT
gtgagggcagctcaggctccagagtctgagcccttctggggcagggcaggaagtgggcag
ggtgggcaagaggtgtcttggatcacggtggagaaatgggtctgggacagaccagtgagg
aagggtctctagctatccctgaggccccgaggggccacctgggcctggccctggctcctg

 1.09 Intr +  11012  11449  438  1  0  101   83   264 0.913  22.25
ctgggacagaccagtgaggaagggtctctagctatccctgaggccccgaggggccacctg
ggcctggccctggctcctgcaggctctgtgataccccgcatgatgccagccacacttgga
ggttggggtggagcacagaggccccccacagagcactgatcaacctccttcctcctttag
CGGATCCGCTCCAACCTGGACATCCGGGCCCTAGACAGCCCCCGAGGCCTTCGGACAGAG
GTCACCTCCAAGATGTTCCAGAAGACGAGGACTGGGTCCTTTCACATCCGGCGGGGGGAA
GTGGTACGCCTCTGTGGGGGCAGCGGGGTGGGGGATAGGCACAGCGCCCCACACCGAGTG
GAATCGTTTAAAACAGCGGTCAAGAGCGTGGCCCCTGGAGTCAGGCAGGCCTGGGTGCAG
ATCCCTGGGCCTAGCCGCTCGGATGAGCCTAGGTTGCTCCTCTGCTTGTTGGTTTCCTCG
GCATGCAAGCGTCGAGCCCGGAGGCTTGCTGGGGCAGTAAATGGGTTAGTGTCACGAAGC
CCAGAGGCCCTGGCCACTGTCATTGTCGCTATGATTGTGACTGCGCTGGGAAGGAGGGAG
TTTCCAGCCCTGAGGGAG
gtgagcaggagctcatttcagggatccagacatctcctaggaacttgggggccgagggcc
ttcaggcatcgatggccccctggtccttggggctgggcctgccttggctgaccacggggc
ccctgcagggtatataccaggtgcagctgcgggcccttgagcacgtggatgggacgcacg

 1.10 Intr +  11578  11739  162  0  0   74   47   281 0.970  23.97
cgctatgattgtgactgcgctgggaaggagggagtttccagccctgagggaggtgagcag
gagctcatttcagggatccagacatctcctaggaacttgggggccgagggccttcaggca
tcgatggccccctggtccttggggctgggcctgccttggctgaccacggggcccctgcag
GGTATATACCAGGTGCAGCTGCGGGCCCTTGAGCACGTGGATGGGACGCACGTGTGCCAG
CTGCCGGAGGACCAGAAGGGCAACATCCATCTGAAACCTTCCTTCTCCGACGGCCTCAAG
ATGGACGCGGGCATCATCTGTGATGTGTGCACCTGCGAGCTG
gtacaacgcagccccgcagggcgggaggggagagctgagccaagcacccagggaccctga
ggaatgaagcaggactcctgtgccccatatcccttgtggggtttcccgaggcacacagga
gagcggaagtgtccagtggccccggtcctgctcccccgacgcaccccaccatggtctctc

 1.11 Intr +  11929  12005   77  0  2   92  105   125 0.995  14.06
agccccgcagggcgggaggggagagctgagccaagcacccagggaccctgaggaatgaag
caggactcctgtgccccatatcccttgtggggtttcccgaggcacacaggagagcggaag
tgtccagtggccccggtcctgctcccccgacgcaccccaccatggtctctctcattccag
CAAAAAGAGGTGCGGTCAGCTCGCTGCAGCTTCAACGGAGACTTCGTGTGCGGACAGTGT
GTGTGCAGCGAGGGCTG
gtgagtggggaagggagttgggcacccaggacaccagtggcccctgatgggaaagctggg
ctcctgcaggggcctggccctgggtgcaccttgtacacctggctgggggtggggcggcaa
tcaaagaaacggctaagggcggggcacacccagttgttggtcaaacccaggtcaaagcac

 1.12 Intr +  13256  13458  203  2  2   55   89   351 0.989  32.04
caagaggcagagcttgcagtgagccaagatcgcgccactgcactccagcctgggcgacaa
ggcgagactccgtctcaaaaaaaaaaataaaataattaaattaaattaaattaaatggga
cagcaaaagccccagctttcctcctgggctgtttcggggaatgaccagttcctccttcag
GAGTGGCCAGACCTGCAACTGCTCCACCGGCTCTCTGAGTGACATTCAGCCCTGCCTGCG
GGAGGGCGAGGACAAGCCGTGCTCCGGCCGTGGGGAGTGCCAGTGCGGGCACTGTGTGTG
CTACGGCGAAGGCCGCTACGAGGGTCAGTTCTGCGAGTATGACAACTTCCAGTGTCCCCG
CACTTCCGGGTTCCTCTGCAATG
gtgagcacaacaactgcggccaatgctgatggcggggtagggagtggacagcaagcatga
ctttcccgtcaggacccaggttgggagagccagacttggaatcagaatccccaagttcag
gcccagcccactctggatgccctgagggccgcccctgagtcctgccccaacctgggcctg

 1.13 Intr +  15817  15920  104  2  2  119   49    65 0.985   6.76
tggaggcagagatggagggaaggagattccaggaaagtgaggaagagatgacttctaccc
caggctagcggcaccctggctcccacagctctgttcccacaggccctccctgccaggtgg
gcagcctggactacaggcacagatgtagctctcatctcccttccttgtccctctctgcag
ACCGAGGACGCTGCTCCATGGGCCAGTGTGTGTGTGAGCCTGGTTGGACAGGCCCAAGCT
GTGACTGTCCCCTCAGCAATGCCACCTGCATCGACAGCAATGGG
gtaggcctgggcataagacagacagtgtctgtcagcaccacccaccctctccagagagaa
ccctatggagagaggagagggagcaggcagggatggggcacagctggctcactggtgccc
cctcctaccccagggcatctgtaatggacgtggccactgtgagtgtggccgctgccactg

 1.14 Intr +  16054  16152   99  0  0  114   77   174 0.999  20.37
gctgtgactgtcccctcagcaatgccacctgcatcgacagcaatggggtaggcctgggca
taagacagacagtgtctgtcagcaccacccaccctctccagagagaaccctatggagaga
ggagagggagcaggcagggatggggcacagctggctcactggtgccccctcctaccccag
GGCATCTGTAATGGACGTGGCCACTGTGAGTGTGGCCGCTGCCACTGCCACCAGCAGTCG
CTCTACACGGACACCATCTGCGAGATCAACTACTCGGCG
gtgaggctaagacctacgaggtgtgggcgtgggaacagggcaggcacagggcagtgtggg
caggaggggctaagcctgatgccacaggagctggccaagggcaagaggtttggggagcgg
gggtctggcagaggcccacccaacacagtgcctgtctgccccgcctttccccgccaagat

 1.15 Intr +  16331  16460  130  1  1   58   75   178 0.963  14.94
cggtgaggctaagacctacgaggtgtgggcgtgggaacagggcaggcacagggcagtgtg
ggcaggaggggctaagcctgatgccacaggagctggccaagggcaagaggtttggggagc
gggggtctggcagaggcccacccaacacagtgcctgtctgccccgcctttccccgccaag
ATCCACCCGGGCCTCTGCGAGGACCTACGCTCCTGCGTGCAGTGCCAGGCGTGGGGCACC
GGCGAGAAGAAGGGGCGCACGTGTGAGGAATGCAACTTCAAGGTCAAGATGGTGGACGAG
CTTAAGAGAG
gtaggggcaggggctgagggttggggttgctgagagcctaggcagcgggcatccaacggg
gcaagggtgtcatcacctggacgggggcttgcagtctgggctaaggtcacacagtccgga
caggaactccagagctgggagggaccacagaacccagatagaggacaccgaatcccagaa

 1.16 Intr +  17088  17210  123  1  0   29   84   290 0.990  24.43
cccaccacacccgttcctgtgcctggtgagagcacggctttgcaaggacttccactcttc
cccaggaggccctgccgtgggtgaggcagatcgcagagtaggggccccctcaccagaccc
tgggtcctctggggcggaggggtgtggctggggtgccctgctgactggctgtgggtacag
CCGAGGAGGTGGTGGTGCGCTGCTCCTTCCGGGACGAGGATGACGACTGCACCTACAGCT
ACACCATGGAAGGTGACGGCGCCCCTGGGCCCAACAGCACTGTCCTGGTGCACAAGAAGA
AGG
gtgagctggtggggccgggcgcagggagggggcgtgtggccagagctcggtggggaggac
aggcaccacctccccctgcctcctcctctccagactgccctccgggctccttctggtggc
tcatccccctgctcctcctcctcctgccgctcctggccctgctactgctgctatgctgga

 1.17 Intr +  17304  17410  107  1  2  118  105    52 0.967  11.00
aggatgacgactgcacctacagctacaccatggaaggtgacggcgcccctgggcccaaca
gcactgtcctggtgcacaagaagaagggtgagctggtggggccgggcgcagggagggggc
gtgtggccagagctcggtggggaggacaggcaccacctccccctgcctcctcctctccag
ACTGCCCTCCGGGCTCCTTCTGGTGGCTCATCCCCCTGCTCCTCCTCCTCCTGCCGCTCC
TGGCCCTGCTACTGCTGCTATGCTGGAAGTACTGTGCCTGCTGCAAG
gtgagcacccagggtgcctcccaaggccccacatcccagggtccccaccccaacagggcc
cccaccctccaccagggtccccagtccccgcctgagttctcatctccccagggtccccaa
ccccttcctgggtccccacctccccagggtccccatcccaacagggtccccatcctccac

 1.18 Intr +  19438  19471   34  0  1  118   64   -14 0.475  -1.87
cccatccccctctatgcccttgtgtgccatgcttacaccctgctaccacctggatattct
ggtgtctggggaggcactgtcacccctcttgaccattggcatggggcggggtggctggaa
gggcttacctgggccagggcagctgtctcaggcctcaccctcacccaccttgtctcctag
GCCTGCCTGGCACTTCTCCCGTGCTGCAACCGAG
gtatgggcctggcatcgcaggggcagcaggggctctgactgctctttctctgagctgggg
tggagggaagctgaacctggaacggcagaggctggaggctctggggtcccacctgaagag
gttgggctgtgcgggtctagggaggggtgccgtgctgaggaccccatcctgcaggtcaca

 1.19 Intr +  19646  19837  192  0  0   35   68   349 0.514  28.27
accgaggtatgggcctggcatcgcaggggcagcaggggctctgactgctctttctctgag
ctggggtggagggaagctgaacctggaacggcagaggctggaggctctggggtcccacct
gaagaggttgggctgtgcgggtctagggaggggtgccgtgctgaggaccccatcctgcag
GTCACATGGTGGGCTTTAAGGAAGACCACTACATGCTGCGGGAGAACCTGATGGCCTCTG
ACCACTTGGACACGCCCATGCTGCGCAGCGGGAACCTCAAGGGCCGTGACGTGGTCCGCT
GGAAGGTCACCAACAACATGCAGCGGCCTGGCTTTGCCACTCATGCCGCCAGCATCAACC
CCACAGAGCTGG
gtgagggcggggctgggcgccacagctctgggcagtgcccttcgggccctctgttccaga
tctgggatcacagcatgcctcttctctgggtgtggggtgcaggcacagggctcagccacc
ttttgccctgtgctgatggtgctatgaacctcatgcctcggtgtgcgtggcctgctggcc

 1.20 Intr +  20124  20227  104  1  2   90   83   203 0.722  21.06
agggctcagccaccttttgccctgtgctgatggtgctatgaacctcatgcctcggtgtgc
gtggcctgctggccaggcatcccctgatcctagcatggttgctggagggatgctctgtgg
tgcctgtcatgcagggggctgaccacctccatctcaccccctcccaccgcctttccttag
TGCCCTACGGGCTGTCCTTGCGCCTGGCCCGCCTTTGCACCGAGAACCTGCTGAAGCCTG
ACACTCGGGAGTGCGCCCAGCTGCGCCAGGAGGTGGAGGAGAAC
gtaaggacccaggaactaggcctggccggagatgtgggtatgagggcgggtgaggtgggc
agggcagagcgaatgcggtcgtggtaccgagattcattaactaggggagaggggtctctc
tggacctgtgcctggcagggggcatcctgggatctgtttccagagggcagaaggccagag

 1.21 Intr +  20559  20617   59  2  2  100  117    78 0.997  10.72
atctgtttccagagggcagaaggccagagcctgggcccaggatgctgccccacggggcat
gccccagccaaccctgaggatctctgggtacagaggctgcctggctccctgggtccccag
cctgagggcttgccacggggtggcctaggcccagcctcacgcccctcccttgcctggcag
CTGAACGAGGTCTACAGGCAGATCTCCGGTGTACACAAGCTCCAGCAGACCAAGTTCCG
gtgagtcccggggtgcccgggttgggtgggggagccgctcctaccgggactccaggagcc
gaagcccccaggccgatcaggcctccacttcagggctatctagctcacagcgccctcttt
gtccccacaggcagcagcccaatgccgggaaaaagtgagtagaagactcgtgggtgagag

 1.22 Intr +  20748  20771   24  0  0  110   87    47 0.960   5.07
gtctacaggcagatctccggtgtacacaagctccagcagaccaagttccggtgagtcccg
gggtgcccgggttgggtgggggagccgctcctaccgggactccaggagccgaagccccca
ggccgatcaggcctccacttcagggctatctagctcacagcgccctctttgtccccacag
GCAGCAGCCCAATGCCGGGAAAAA
gtgagtagaagactcgtgggtgagagggcccccacttcctgcccgcctgtccccagccca
gccactgcctcgtccgtccctactccatctccatcccataggaagggagggtcagatgtg
tccgtcaggttcggaccttcattcgttcctttgaccatttcttcaacaaatgctaatgtg

 1.23 Intr +  22107  22255  149  0  2   81   53   242 0.989  21.07
ggctgcagggtaaagggtatggggctggcataggcctggagcactgcctgcctctgaaga
ccctgcacttcttgctgtcttacatcctggcccctgaaggggagaagacaggcaggaggg
acagggcagcaggtgccagcctgacccctccgctgcctgaaccttccaccctcgacccag
GCAAGACCACACCATTGTGGACACAGTGCTGATGGCGCCCCGCTCGGCCAAGCCGGCCCT
GCTGAAGCTTACAGAGAAGCAGGTGGAACAGAGGGCCTTCCACGACCTCAAGGTGGCCCC
CGGCTACTACACCCTCACTGCAGACCAGG
gtaggagggcgggtccgctgtgccactgcctcgcacctcccgcctgtgtggccctgtgac
ccacctctgaccacctccgaacccccacccagacgcccggggcatggtggagttccagga
gggcgtggagctggtggacgtacgggtgcccctctttatccggcctgaggatgacgacga

 1.24 Intr +  22348  22527  180  2  0   89   98   445 0.999  46.64
ctgaagcttacagagaagcaggtggaacagagggccttccacgacctcaaggtggccccc
ggctactacaccctcactgcagaccagggtaggagggcgggtccgctgtgccactgcctc
gcacctcccgcctgtgtggccctgtgacccacctctgaccacctccgaacccccacccag
ACGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGACGTACGGGTGCCCC
TCTTTATCCGGCCTGAGGATGACGACGAGAAGCAGCTGCTGGTGGAGGCCATCGACGTGC
CCGCAGGCACTGCCACCCTCGGCCGCCGCCTGGTAAACATCACCATCATCAAGGAGCAAG

gtgggtctgggtggggagagtggggaaggcagacgggggctcgggggcactggttcctcc
tgcttaagtggaattgcgacctggccacgtggcctgggctagtcacttaacctctgcaag
ccttggtttctccatctgtaaaatgggtaagggctcttttacggaatgcgtggctgttca

 1.25 Intr +  23479  23627  149  2  2   93   76   270 0.988  27.44
cctcatctttttctggaaggattttccgtttcgctcctgtgcccttcccagagggcaatg
catagagggaaccaagcggactcctggattctgggctgggctgggcagggtcacaggaga
gcaggaggtgggaagggactgggcccagcacactctgacaaatgcccgggctccttgcag
CCAGAGACGTGGTGTCCTTTGAGCAGCCTGAGTTCTCGGTCAGCCGCGGGGACCAGGTGG
CCCGCATCCCTGTCATCCGGCGTGTCCTGGACGGCGGGAAGTCCCAGGTCTCCTACCGCA
CACAGGATGGCACCGCGCAGGGCAACCGG
gtgaggctgcgccacagggtcgagggtgcagcccggggggctgcgtgggcaccgcattgg
gttcccaagacaaagcagcacatggcagctgcttgagtccctggatactggccgtgcccc
tggctggcctcccaaggacacgtccacctgctcctgccaccctgtggcaggggagtctca

 1.26 Intr +  28607  28811  205  1  1  136   96   257 0.987  31.29
ttacgcctcaaaaaaaaaaacaaacaaaaaaaacacaaaaacctgaacctcgtgtaagta
ctccacccagcaagcagggatggtctctgcagtgtccatgaggttgggagggagcgtgtg
gccatgactcttgcctcagcccccagccatgaccctgaccctgaccccctccactcccag
GACTACATCCCCGTGGAGGGTGAGCTGCTGTTCCAGCCTGGGGAGGCCTGGAAAGAGCTG
CAGGTGAAGCTCCTGGAGCTGCAAGAAGTTGACTCCCTCCTGCGGGGCCGCCAGGTCCGC
CGTTTCCACGTCCAGCTCAGCAACCCTAAGTTTGGGGCCCACCTGGGCCAGCCCCACTCC
ACCACCATCATCATCAGGGACCCAG
gtaggcagagcctgggggtcggcttaagcaggaggagagggaagactggggggtctctca
actaggtctgtcagacttagcaaatccaaacacaggacgcccaggtaaatctgaatttca
ggtaaacaacatacacgttggtaggataagtatgtcccatgcaatatttggaacatactt

 1.27 Intr +  29877  30034  158  1  2    6   86   149 0.770   7.42
gcttggcaggatgctctatgtggcagcaatggggcaccaccaggtctccagagacgcggg
tgggcaggtctgagttgaatgcgctgggtagagcgccctgggtgttgaagtgggtctctg
gcgccccctggtggtgaagggggatctgagtggttgcccggccccaacctgacccgttag
ATGAACTGGACCGGAGCTTCACGAGTCAGATGTTGTCATCACAGCCACCCCCTCACGGCG
ACCTGGGCGCCCCGCAGAACCCCAATGCTAAGGCCGCTGGGTCCAGGAAGATCCATTTCA
ACTGGCTGCCCCCTTCTGGCAAGCCAATGGGGTACAGG
gtaaggcggggggctgagggtcacgacaggtggatgggcggtctggcaccagcactcaca
gaagaggtgggccgtccaaggccagggccccctgagagagagcagacagtggaacctagc
acaggtggtcagagggaaacccggtctgtgctgggaaagagggaagacccattcctgagt

 1.28 Intr +  30446  30626  181  1  1   79  100   347 0.999  35.64
atgggagatacccccacctgctctgccctagtcctgacgtgtgcacatggcagatctctc
agcccctccctcgggcctcatctgtgcaaagaggacagtaagggcagaggtcagaggagg
gacaggcagcttgggtgcctgctgctccctgctgaccaggacccctgtccctgggggtag
GTAAAGTACTGGATTCAGGGTGACTCCGAATCCGAAGCCCACCTGCTCGACAGCAAGGTG
CCCTCAGTGGAGCTCACCAACCTGTACCCGTATTGCGACTATGAGATGAAGGTGTGCGCC
TACGGGGCTCAGGGCGAGGGACCCTACAGCTCCCTGGTGTCCTGCCGCACCCACCAGGAA
G
gtgaggcctcgccatgtctgtccatttgtcccctggctgccctgatgccagcatgcccag
acctccctccctctgccactgacagcactcttcctgtattccccgctccctagtgcccag
cgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagctgggc

 1.29 Intr +  30740  30877  138  0  0  100   66   218 0.999  22.42
tgcgcctacggggctcagggcgagggaccctacagctccctggtgtcctgccgcacccac
caggaaggtgaggcctcgccatgtctgtccatttgtcccctggctgccctgatgccagca
tgcccagacctccctccctctgccactgacagcactcttcctgtattccccgctccctag
TGCCCAGCGAGCCAGGGCGTCTGGCCTTCAATGTCGTCTCCTCCACGGTGACCCAGCTGA
GCTGGGCTGAGCCGGCTGAGACCAACGGTGAGATCACAGCCTACGAGGTCTGCTATGGCC
TGGTCAACGATGACAACC
gtaagaaccagatccttctttcctgcccacagggagaacagccatggaaggggaggggac
aaagctggagggagctcttggtcactccctggacctgctgtgcagggcactcgaggcctt
catcctggtcagcggataagcctgaggcatctttagggttttggccagatttgggctggg

 1.30 Intr +  31940  32122  183  0  0  105   81   392 0.980  41.16
cgccagtcatgctgacgctcagggctccgcaggcggcaattcagcagtggctggctttgc
cttgcttccccagcccctgggtgccatccaggggatgcacggccgtcctgctgtgtcagg
ggtggtgttgggaccaggctgggacctgggtgaccctctgaagcactctctctgccccag
GACCTATTGGGCCCATGAAGAAAGTGCTGGTTGACAACCCTAAGAACCGGATGCTGCTTA
TTGAGAACCTTCGGGAGTCCCAGCCCTACCGCTACACGGTGAAGGCGCGCAACGGGGCCG
GCTGGGGGCCTGAGCGGGAGGCCATCATCAACCTGGCCACCCAGCCCAAGAGGCCCATGT
CCA
gtgagtggtgggcagggaggtgaggggcagaccgggcaggggggcagggggcagcagcca
gggccctggctcactcccctgccctgcagtccccatcatccctgacatccctatcgtgga
cgcccagagcggggaggactacgacagcttccttatgtacagcgatgacgttctacgctc

 1.31 Intr +  32212  32343  132  2  0   93  105   253 0.996  29.30
tacacggtgaaggcgcgcaacggggccggctgggggcctgagcgggaggccatcatcaac
ctggccacccagcccaagaggcccatgtccagtgagtggtgggcagggaggtgaggggca
gaccgggcaggggggcagggggcagcagccagggccctggctcactcccctgccctgcag
TCCCCATCATCCCTGACATCCCTATCGTGGACGCCCAGAGCGGGGAGGACTACGACAGCT
TCCTTATGTACAGCGATGACGTTCTACGCTCTCCATCGGGCAGCCAGAGGCCCAGCGTCT
CCGATGACACTG
gtgagtggagacctgggacccacaagaggacagtgggggtcttgggtacagagtgagtcc
actgggtccagagagggcaaaggggccagcaactagaggacatggaggttaaggcagcct
tggacaaatgcaatggagtgcacatctgtgcatggggcacaggaaccagtgcctggggga

 1.32 Intr +  33531  33740  210  1  0   77   46   356 0.730  30.40
tcacctgccgcggccttcccgctccggccgtgcgcatctacccccgcccccaacacacac
cccgggatcccgggagctggagacgggctcccctcgcagagcctacggccttcccccgcc
tggccctgctcggcccggcgccccccggcggtgccaacgcggcccttcgttgttcccaag
GCTGCGGCTGGAAGTTCGAGCCCCTGCTGGGGGAGGAGCTGGACCTGCGGCGCGTCACGT
GGCGGCTGCCCCCGGAGCTCATCCCGCGCCTGTCGGCCAGCAGCGGGCGCTCCTCCGACG
CCGAGGCGCCCCACGGGCCCCCGGACGACGGCGGCGCGGGCGGGAAGGGCGGCAGCCTGC
CCCGCAGTGCGACACCCGGGCCCCCCGGAG
gtgacaggctcacccgccgccccccgatccgcgcccacccagcctcactcgcgcctgagg
gcctggggtgggcgtctgcgctgcctcgggggccccagtttcagccaggcccgggccttg
gcggctgggagcacagctgctcagaggcagggcccagtgccaggggacgcgtgaggcagg

 1.33 Intr +  34342  34581  240  2  0  120  113   255 0.996  29.96
ggcccttgggctcctgcagggacagagggcctctgtccctagtggtttgagggaaactgg
ttgtatttaagcaaaagccacccagagggtgggtgaccaggaatgtgcagggcccagcct
gccccacggggcccgggtctggggcaggcctgaccaagggaccctgctctccccctgcag
AGCACCTGGTGAATGGCCGGATGGACTTTGCCTTCCCGGGCAGCACCAACTCCCTGCACA
GGATGACCACGACCAGTGCTGCTGCCTATGGCACCCACCTGAGCCCACACGTGCCCCACC
GCGTGCTAAGCACATCCTCCACCCTCACACGGGACTACAACTCACTGACCCGCTCAGAAC
ACTCACACTCGACCACACTGCCCAGGGACTACTCCACCCTCACCTCCGTCTCCTCCCACG

gtgagtgacctcagccaaccctgcctctcccactaacccttcctctcttccagctcctgg
agcctcgggcttctgtctgctgtccccaccgcccattctccaacatacacacacgcatgc
acacatgcacgcacacacgtgcacacgcatgcacacatgtacacagacatgcatgcgcac

 1.34 Intr +  34635  34763  129  1  0  120   38    14 0.728   1.44
ccccaccgcgtgctaagcacatcctccaccctcacacgggactacaactcactgacccgc
tcagaacactcacactcgaccacactgcccagggactactccaccctcacctccgtctcc
tcccacggtgagtgacctcagccaaccctgcctctcccactaacccttcctctcttccag
CTCCTGGAGCCTCGGGCTTCTGTCTGCTGTCCCCACCGCCCATTCTCCAACATACACACA
CGCATGCACACATGCACGCACACACGTGCACACGCATGCACACATGTACACAGACATGCA
TGCGCACAC
gtacacacatgcatgcacactccctgctcctctcactcttgttttgtcctgccctaggcc
tccctcccatctgggaacacgggaggagcaggcttccgctgtcctgggccctggggtccc
ggagtcgggctcagatgaaagggttccccccttccaggggcccacgagactctataatcc

 1.35 Intr +  35467  35616  150  2  0   98   77   198 0.999  21.02
tggaggatgtgcggtaggtgctgggcagcctggacagggtgttgcagggtgagtgagttg
tccagccagcggtcagtgtagacatgccagctgagggagggaggtcagggggcagcactg
tgactcccactgagaccctagcccctgcatctctggctgactgcggcctcctgtccccag
ACTCTCGCCTGACTGCTGGTGTGCCCGACACGCCCACCCGCCTGGTGTTCTCTGCCCTGG
GGCCCACATCTCTCAGAGTGAGCTGGCAGGAGCCGCGGTGCGAGCGGCCGCTGCAGGGCT
ACAGTGTGGAGTACCAGCTGCTGAACGGCG
gtgaggcatggtggctgccaggctgcggggtgcagccctgcaaggcctggccccagtgtg
acacatagggtacctcagctgtgtcaggaacccacccaagtcccttgagcgctaaagccc
ccatccagcctgagagggtctcccaccccattctccaccccacttctttgcctcccctct

 1.36 Intr +  36195  36383  189  1  0  102  109   212 0.989  25.47
cttgtatagtacacaatctgaacaaccagccataccatactgtacccaacctgtacccaa
accacagctagtcctgggtgggtgataactaggtctcgatggcagcttagggacgaggag
gatcaggccaggggtgggagtaacactgcactactgtgtgcccccacctgatccccccag
GTGAGCTGCATCGGCTCAACATCCCCAACCCTGCCCAGACCTCGGTGGTGGTGGAAGACC
TCCTGCCCAACCACTCCTACGTGTTCCGCGTGCGGGCCCAGAGCCAGGAAGGCTGGGGCC
GAGAGCGTGAGGGTGTCATCACCATTGAATCCCAGGTGCACCCGCAGAGCCCACTGTGTC
CCCTGCCAG
gtgagttgcctcccccagccccagagctgcccccatcatgcccaccacccacccacaggc
tgatgctcttcctctactgcccccaggctccgccttcactttgagcactcccagtgcccc
aggcccgctggtgttcactgccctgagcccagactcgctgcagctgagctgggagcggcc

 1.37 Intr +  36470  36625  156  0  0  103   38   212 0.752  18.87
gcccagagccaggaaggctggggccgagagcgtgagggtgtcatcaccattgaatcccag
gtgcacccgcagagcccactgtgtcccctgccaggtgagttgcctcccccagccccagag
ctgcccccatcatgcccaccacccacccacaggctgatgctcttcctctactgcccccag
GCTCCGCCTTCACTTTGAGCACTCCCAGTGCCCCAGGCCCGCTGGTGTTCACTGCCCTGA
GCCCAGACTCGCTGCAGCTGAGCTGGGAGCGGCCACGGAGGCCCAATGGGGATATCGTCG
GCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAG
gtgctgcccaccccgggggcaggagtggccaggggaggggtaaagagggggccgcagacg
ctgaaggcatcttccctgctcagggccagccaccgcattccgggtggatggagacagccc
cgagagccggctgaccgtgccgggcctcagcgagaacgtgccctacaagttcaaggtgca

 1.38 Intr +  36709  36873  165  2  0   54   80   296 0.998  26.53
agcccagactcgctgcagctgagctgggagcggccacggaggcccaatggggatatcgtc
ggctacctggtgacctgtgagatggcccaaggaggaggtgctgcccaccccgggggcagg
agtggccaggggaggggtaaagagggggccgcagacgctgaaggcatcttccctgctcag
GGCCAGCCACCGCATTCCGGGTGGATGGAGACAGCCCCGAGAGCCGGCTGACCGTGCCGG
GCCTCAGCGAGAACGTGCCCTACAAGTTCAAGGTGCAGGCCAGGACCACTGAGGGCTTCG
GGCCAGAGCGCGAGGGCATCATCACCATAGAGTCCCAGGATGGAG
gtaggcacctgtcctttccttcacccccacccctcctcgggccgtgcctccttctggcac
caccctctgactggcctatctgcccaccccaggacccttcccgcagctgggcagccgtgc
cgggctcttccagcacccgctgcaaagcgagtacagcagcatcaccaccacccacaccag

 1.39 Intr +  36966  37076  111  1  0  104   80   141 0.999  16.42
ccctacaagttcaaggtgcaggccaggaccactgagggcttcgggccagagcgcgagggc
atcatcaccatagagtcccaggatggaggtaggcacctgtcctttccttcacccccaccc
ctcctcgggccgtgcctccttctggcaccaccctctgactggcctatctgcccaccccag
GACCCTTCCCGCAGCTGGGCAGCCGTGCCGGGCTCTTCCAGCACCCGCTGCAAAGCGAGT
ACAGCAGCATCACCACCACCCACACCAGCGCCACCGAGCCCTTCCTAGTGG
gtgagcactgagggctaggggatcccggctctcctgggacagggagctagcagagggaga
agggcagaccccaagccaggtcatctaatgcctcctcctccacagatgggctgaccctgg
gggcccagcacctggaggcaggcggctccctcacccggcatgtgacccaggagtttgtga

 1.40 Term +  37182  37321  140  1  2   97   47   112 0.999   7.07
tccagcacccgctgcaaagcgagtacagcagcatcaccaccacccacaccagcgccaccg
agcccttcctagtgggtgagcactgagggctaggggatcccggctctcctgggacaggga
gctagcagagggagaagggcagaccccaagccaggtcatctaatgcctcctcctccacag
ATGGGCTGACCCTGGGGGCCCAGCACCTGGAGGCAGGCGGCTCCCTCACCCGGCATGTGA
CCCAGGAGTTTGTGAGCCGGACACTGACCACCAGCGGAACCCTTAGCACCCACATGGACC
AACAGTTCTTCCAAACTTGA
ccgcaccctgccccacccccgccacgtcccactaggcgtcctcccgactcctctcccgga
gcctcctcagctactccatccttgcacccctgggggcccagcccacccgcatgcacagag
caggggctaggtgtctcctgggaggcatgaagggggcaaggtccgtcctctgtgggccca

 2.04 PlyA -  37728  37723    6                               1.05
 2.03 Term -  37893  37822   72  0  0   88   54    90 0.998   4.41
 2.02 Intr -  38138  37976  163  1  1   95   80   197 0.998  20.77
 2.01 Intr -  38365  38215  151  2  1  103   94   173 0.441  19.81

Predicted peptide sequence(s):


>ITGB4_1|GENSCAN_predicted_peptide_1|1977_aa
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEVPGVGTGETQIDTTLRRSQMSPQGLRVRLRPG
EERHFELEVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGK
FVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPE
GGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTT
GTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSS
NIVELLEEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVVRLCGGSG
VGDRHSAPHRVESFKTAVKSVAPGVRQAWVQIPGPSRSDEPRLLLCLLVSSACKRRARRL
AGAVNGLVSRSPEALATVIVAMIVTALGRREFPALREGIYQVQLRALEHVDGTHVCQLPE
DQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQ
TCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSG
FLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSL
YTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVV
VRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLLLLPLLALL
LLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLRSGNLKGRD
VVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTRECAQLRQEVE
ENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLKLTEKQVEQ
RAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVP
AGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRT
QDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFHVQLSNPKF
GAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGSRKIHFNWL
PPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYS
SLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNRPIG
PMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPI
IPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLGEELDLRRV
TWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMD
FAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPR
DYSTLTSVSSHAPGASGFCLLSPPPILQHTHTHAHMHAHTCTRMHTCTQTCMRTHSRLTA
GVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSV
VVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFTLSTPSAPG
PLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATAFRVDGDSPESRLTVPG
LSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSRAGLFQHPLQSEYSSITT
THTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQQFFQT

>ITGB4_1|GENSCAN_predicted_peptide_2|128_aa
XARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPE
LDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAA
DGAKVLCL