GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:12:51

Sequence HOXB4_1 : 4334 bp : 55.01% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1279   1729  451  0  1   44  100   432 0.794  36.12
tgagcagatttccttatccgggaatcgcaggcggggcggccattggctcggaggatcacg
tgggcgcctaactttgttcacttgacagtaagtaggagggctttcggaaacaggaaaacg
agtcaggggtcggaataaattttagtatattttgtgggcaattcccagaaattaatggct
ATGAGTTCTTTTTTGATCAACTCAAACTATGTCGACCCCAAGTTCCCTCCATGCGAGGAA
TATTCACAGAGCGATTACCTACCCAGCGACCACTCGCCCGGGTACTACGCCGGCGGCCAG
AGGCGAGAGAGCAGCTTCCAGCCGGAGGCGGGCTTCGGGCGGCGCGCGGCGTGCACCGTG
CAGCGCTACGCGGCCTGCCGGGACCCTGGGCCCCCGCCGCCTCCGCCACCACCCCCGCCG
CCCCCGCCACCGCCCGGTCTGTCCCCTCGGGCTCCTGCGCCGCCACCCGCCGGGGCCCTC
CTCCCGGAGCCCGGCCAGCGCTGCGAGGCGGTCAGCAGCAGCCCCCCGCCGCCTCCCTGC
GCCCAGAACCCCCTGCACCCCAGCCCGTCCCACTCCGCGTGCAAAGAGCCCGTCGTCTAC
CCCTGGATGCGCAAAGTTCACGTGAGCACGG
gtgagtgcgtgggcaccccttccccctcccacccctggagctttacaccaaagggacttc
ggaggcatgggttgggggggggttgagctggggaagccaattgtccccgctataaactcg
ccattgccggagatttacggtcgcctgttttcagagccacataattacatcccccataaa

 1.02 Term +   2572   2870  299  2  2   61   39   531 0.976  41.27
tctctttctcattcttgggtcttgcattcttcccttttcgtttttccccgctctccctca
gaaggaagaagaggtggcgggagagggagggagggaaacgctgtgttccctggaagaaag
gactctctctttcgggggcaataaaactttctctttctccctctctccgtgtgtgtccag
TAAACCCCAATTACGCCGGCGGGGAGCCCAAGCGCTCTCGGACCGCCTACACGCGCCAGC
AGGTCTTGGAGCTGGAGAAGGAATTTCACTACAACCGCTACCTGACACGGCGCCGGAGGG
TGGAGATCGCCCACGCGCTCTGCCTCTCCGAGCGCCAGATCAAGATCTGGTTCCAGAACC
GGCGCATGAAGTGGAAAAAAGACCACAAGTTGCCCAACACCAAGATCCGCTCGGGTGGTG
CGGCAGGCTCAGCCGGAGGGCCCCCTGGCCGGCCCAATGGAGGCCCCCGCGCGCTCTAG
tgcccccgcacgcgggagccacgaacctcggggtgggggtgggcagtgagtgcaggggat
ggggtggggggacaggagggggccctggggcctgggccccggaaaaatctatctgccctc
ccccacactttatatacgaataaacgcagaagagggggaggggaagctttatttatagaa

Predicted peptide sequence(s):


>HOXB4_1|GENSCAN_predicted_peptide_1|249_aa
MSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTV
QRYAACRDPGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPPC
AQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFH
YNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPG
RPNGGPRAL