GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:13:51

Sequence GIP_1 : 12437 bp : 52.09% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2562   2647   86  2  2   73   91   196 0.999  16.65
actcccacctggacgacagagcgagactccatctcaaaaaaaaaaaaaaaaaagaaaaag
gaaaagaaagggtccaaacctcagggctttgcccctctccagctttcagaacccctactg
gttgctctctcaacatgtcctggcttttttctgtcttagctcaggaaataaccttggaag
ATGGTGGCCACGAAGACCTTTGCTCTGCTGCTGCTGTCCCTGTTCCTGGCAGTGGGACTA
GGAGAGAAGAAAGAGGGTCACTTCAG
gtaggagtggtgagaggaaagggatggggcagaggaggggttaggggatgacaggttctg
gatttgtttctagggggagatgagaaagggaaggaatccaggctaagaggtaggaagctc
cagggaaatacctgccggcagcgtgagtgcaaagtgagcactgagccagagaggatttat

 1.02 Intr +   5314   5484  171  1  0  102   61   167 0.997  14.97
agtgggccctggagctgaggataaagcctggggtggggtgggggagtggatccacaggga
gtctccataaaaacggactggtttgttttcaagtgtctgcctcctgttagtgacagtcat
ttaccctagcattgtgattctccccccatctctgccccttctccgcacccttgtttccag
CGCTCTCCCCTCCCTGCCTGTTGGATCTCATGCTAAGGTGAGCAGCCCTCAACCTCGAGG
CCCCAGGTACGCGGAAGGGACTTTCATCAGTGACTACAGTATTGCCATGGACAAGATTCA
CCAACAAGACTTTGTGAACTGGCTGCTGGCCCAAAAGGGGAAGAAGAATGA
gtgagtcgctgcttacactcctcctgttccctgtgccgggctctgccttcctaccttcag
aggaggccaccggctgtggccacacaggccacatgatgcacaaccccaggtggcaccttt
ctttttcttttcttttttttttttttttttgagatggagtctcactctttcgcccaggct

 1.03 Intr +   7975   8067   93  1  0   92  105    79 0.998   9.58
tggtcagcacggtagattctgaaaagctgttcactggtggaggcagctgaagaccactgt
taggtggggttgagtggaaaaaggtaccctctgcttttggggttcagatattaaaagatt
caagtgtccctagactggagtctccgcagcttgcccactctctaatctttatcttcccag
CTGGAAACACAACATCACCCAGAGGGAGGCTCGGGCGCTGGAGCTGGCCAGTCAAGCTAA
TAGGAAGGAGGAGGAGGCAGTGGAGCCACAGAG
gtgagtcagggcgcagagggaagggagggagccaagcctcctgccccgcccccacctctt
tgttccctctccctgaccccagagcagagcaaggacctgagataagcatcctcttcctct
cagagttcaaagaggggtcttcattgagcaaactcctggaggtcagcccaagcttaagga

 1.04 Intr +   8807   8908  102  2  0   51   91   115 0.721   7.89
gctgggtggggctggcagaaaggaggctccagatctcagagctgagccaacggagagata
gctgtgtcggctccctccccccatccgcggctgcccctcagtggtgtccccaaccctgtg
tttaccctctctgggcgaagctcaggctaaaatagttagccagagactgttcccttgcag
CTCCCCAGCCAAGAACCCCAGCGATGAAGATTTGCTGCGGGACTTGCTGATTCAAGAGCT
GTTGGCCTGCTTGCTGGATCAGACAAACCTCTGCAGGCTCAG
gtaggggagtgtggtgttgcacagcggttctaacttgagcttgggcatcagacatggatt
cagatctttgcccctccacatgctggctgattacatagcctttctgaacctcagtgtttt
cactaaaatcagaggtatagaatcatttcacaggattgttgtcagctttaagtaagagaa

Predicted peptide sequence(s):


>GIP_1|GENSCAN_predicted_peptide_1|151_aa
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
KNPSDEDLLRDLLIQELLACLLDQTNLCRLX