GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:54:45

Sequence G6PC_1 : 14971 bp : 46.57% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1280   1509  230  1  2   69   83   186 0.481  14.04
tacattttagacaaacgtggtttttgagtccaaagatcagggctgggttgacctgaatac
tggatacagggcatataaaacaggggcaaggcacagactcatagcagagcaatcaccacc
aagcctggaataactgcaagggctctgctgacatcttcctgaggtgccaaggaaatgagg
ATGGAGGAAGGAATGAATGTTCTCCATGACTTTGGGATCCAGTCAACACATTACCTCCAG
GTGAATTACCAAGACTCCCAGGACTGGTTCATCTTGGTGTCCGTGATCGCAGACCTCAGG
AATGCCTTCTACGTCCTCTTCCCCATCTGGTTCCATCTTCAGGAAGCTGTGGGCATTAAA
CTCCTTTGGGTAGCTGTGATTGGAGACTGGCTCAACCTCGTCTTTAAGTG
gtaagaaccatatagagaggagatcagcaagaaaagaggctggcattcgctctcgcaatg
tctgtccatcagaagttgctttccccaggctattcaggaagccacgggctactcatgctt
ccaacccctctctctgactttggatcatctacataaagggggaagacagaaaaaatccta

 1.02 Intr +   4334   4443  110  2  2   92  115    94 0.998  12.43
ttacatacataaggaagtgtcatgaaatatctccctctcacacttctccccagccaccca
gttctcccttctagaggcaacatgtgaaatccttctcaggctacactcttcttgaaggtg
taggctttgggcaaaagcattcattcagtaaccccagaaacttgttctgtttttccatag
GATTCTCTTTGGACAGCGTCCATACTGGTGGGTTTTGGATACTGACTACTACAGCAACAC
TTCCGTGCCCCTGATAAAGCAGTTCCCTGTAACCTGTGAGACTGGACCAG
gtaagcgtcccagcccctgcagacagaagctgagtggacctcgtttacctgttatggatg
aaactgaccttgaggggacatgaggagagccattcctttgtacttttgtcatgctcttca
attggcacaaattaattcacttctgcaatactttcctgaatagcacagtagtattggaaa

 1.03 Intr +   7926   8031  106  1  1  119  103    46 0.986   8.47
aacgaatggatggtaagatgggtggatggatggggggtgaacggatggatggggggtgaa
tggatggatgaatgggtagatgggtggatagggggatggctgggtggctgggtagatgat
gcactgtctcccagatgaggaccttttcacctttactccattctctttcctgccctttag
GGAGCCCCTCTGGCCATGCCATGGGCACAGCAGGTGTATACTACGTGATGGTCACATCTA
CTCTTTCCATCTTTCAGGGAAAGATAAAGCCGACCTACAGATTTCG
gtaagaactcaccactggggtgtaggtggtggagggcaggaggcagctctctctgtagct
gacacaccacgtattcttcctcacatccccctagcccgctcccacacctgggcagccgct
gattaagagttgtggcactttggatagggataaacctcagagtcagggaatgtttgggct

 1.04 Intr +   9706   9821  116  1  2  126   80   -10 0.975   2.09
tctgagccgctgcacccagcccccaacaggcatctttggacttttgagtactggctttaa
tttacaaaaattccactgagagcacctaagtttgccaggctccaacatttctgcaggggc
tgttttctttgctgaaggatctgcacctgtgttctgttatggttgcctcttctgttgcag
GTGCTTGAATGTCATTTTGTGGTTGGGATTCTGGGCTGTGCAGCTGAATGTCTGTCTGTC
ACGAATCTACCTTGCTGCTCATTTTCCTCATCAAGTTGTTGCTGGAGTCCTGTCAG
gtatgggctgatctgactcccttccttctcccccaaaccccattccgtttctctccctaa
tcaggacaaaatcccagcattccagccacatcctgtgtgtaatcagtactgttagcattt
ctgtgggttgaaagtcaagaatgagcaacttgaaatgattaatttctataagagtgccca

 1.05 Term +  11318  11829  512  0  2   84   48   566 0.914  46.74
tatattgagggcaggctggagtcacacatgggaataagccaggcgaccctcccatctgcc
atctgtgatttaattccacagtcgcagaacggatggcatgtcacccactcctccaaaccc
acctctagcaaaggtcccaaatccttcctatctctcacagtcatgctttcttccactcag
GCATTGCTGTTGCAGAAACTTTCAGCCACATCCACAGCATCTATAATGCCAGCCTCAAGA
AATATTTTCTCATTACCTTCTTCCTGTTCAGCTTCGCCATCGGATTTTATCTGCTGCTCA
AGGGACTGGGTGTAGACCTCCTGTGGACTCTGGAGAAAGCCCAGAGGTGGTGCGAGCAGC
CAGAATGGGTCCACATTGACACCACACCCTTTGCCAGCCTCCTCAAGAACCTGGGCACGC
TCTTTGGCCTGGGGCTGGCTCTCAACTCCAGCATGTACAGGGAGAGCTGCAAGGGGAAAC
TCAGCAAGTGGCTCCCATTCCGCCTCAGCTCTATTGTAGCCTCCCTCGTCCTCCTGCACG
TCTTTGACTCCTTGAAACCCCCATCCCAAGTCGAGCTGGTCTTCTACGTCTTGTCCTTCT
GCAAGAGTGCGGTAGTGCCCCTGGCATCCGTCAGTGTCATCCCCTACTGCCTCGCCCAGG
TCCTGGGCCAGCCGCACAAGAAGTCGTTGTAA
gagatgtggagtcttcggtgtttaaagtcaacaaccatgccagggattgaggaggactac
tatttgaagcaatgggcactggtatttggagcaagtgacatgccatccattctgccgtcg
tggaattaaatcacggatggcagattggagggtcgcctggcttattcccatgtgtgactc

Predicted peptide sequence(s):


>G6PC_1|GENSCAN_predicted_peptide_1|357_aa
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV
ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL