GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:17:46

Sequence CHAD_1 : 6862 bp : 59.28% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1350   2123  774  2  0   92  105  1752 0.902 170.45
tctgggcgcgagcgagttaagcccagtggcctcgatgctccacgtaggagctggctcggc
tgccggctgcggtcagggccaccgtataaagagggcggcagacccgagcgcctaggactc
gccgctgcccgcgccccgccgccgctgctgcccccagccccggccccaggcgtcccagcc
ATGGTCCGCCCAATGCTCTTGCTCAGCCTCGGCCTCCTGGCTGGTCTGCTGCCGGCGCTG
GCCGCCTGCCCCCAGAACTGCCACTGCCACAGCGACCTGCAGCACGTCATCTGCGACAAG
GTGGGGCTGCAGAAGATCCCCAAGGTGTCAGAGAAGACCAAGCTGCTCAACCTACAGCGC
AACAACTTCCCGGTGCTGGCTGCCAATTCGTTCCGGGCCATGCCGAACCTCGTGTCATTG
CACCTGCAGCACTGCCAGATCCGCGAGGTGGCCGCCGGTGCCTTCCGCGGCCTCAAGCAA
CTTATCTACTTGTACCTGTCCCATAACGACATCCGCGTGCTGCGCGCAGGTGCCTTCGAC
GACCTGACCGAGCTGACCTACCTCTACCTGGACCACAACAAGGTCACTGAGCTGCCCCGG
GGGTTGCTCTCCCCGCTGGTCAACCTCTTCATCTTGCAGCTCAACAACAACAAGATCCGT
GAGCTGCGCGCAGGCGCCTTCCAGGGAGCCAAGGACCTGCGCTGGCTCTACCTGTCGGAA
AACGCGTTGAGCTCCCTGCAGCCCGGGGCCCTGGACGACGTGGAGAACCTCGCCAAATTC
CACGTGGACAGGAACCAGCTGTCCAGCTACCCCTCAGCTGCCCTGAGCAAGCTACGGGTG
GTGGAGGAGCTGAAGCTGTCCCACAACCCCCTGAAAAGCATCCCGGACAATGCCTTCCAG
TCCTTTGGCAGATACCTGGAGACCCTCTGGCTGGACAACACCAACCTGGAGAAG
gtgagctcctggctgtgggctctgccctggttccttcttcccttcctggaggccccagga
gccagggccacagctggcaccatcccccgtccccaggttccctgtccctctggctatctc
caaggtgagcagctctgccacctcccttcctcgccttgtcacatccctaccctaatccct

 1.02 Intr +   4293   4456  164  2  2   88   95   188 0.986  19.47
agggggttgtgtagattggattatctgagatcacttggtcatactgctttgaaaactggg
aaactcctcaaagtgctatggctcaggttcagggaaggatcctgcccctctggcactcgg
gtgcttactcattcactcatgaccaccttgctcccaccttgctcccaccttgctccccag
TTCTCAGATGGTGCCTTCCTGGGTGTAACCACGCTGAAACACGTCCATTTGGAGAACAAC
CGCTTGAACCAGCTACCCTCCAACTTCCCCTTCGACAGCCTGGAGACCCTCGCCCTTACC
AATAACCCCTGGAAGTGTACCTGCCAGCTCCGGGGCCTTCGGCG
gtaagaacacttccatgtcactcccagagcccaccctcatgtgatagaggcacattagcc
ctgcactaagacatgttggacatgcatcctagatctgctacctaataagcatgggaccct
gggagcctcagtttccccatttgtaaaatgaagatgacagcttcagactatcctgtggcc

 1.03 Term +   4724   4865  142  2  1   91   41   193 0.950  13.24
cctagatctgctacctaataagcatgggaccctgggagcctcagtttccccatttgtaaa
atgaagatgacagcttcagactatcctgtggccaagtcaatcctggccccatagttcact
gcccttccccccagcactcccaccttcttccccagccccagcaagtttctgtctctccag
GTGGCTGGAAGCCAAGGCCTCCCGCCCAGATGCCACCTGTGCCTCACCTGCCAAGTTCAA
GGGCCAGCACATCCGTGACACGGACGCCTTCCGCAGCTGCAAGTTCCCCACCAAGAGGTC
CAAGAAAGCTGGCCGCCATTAA
acaggtgggggccaggtaaacaggtcccctatgtccctctttggtgattccagcaagtga
gctggtatcttccaggataccccctggccctggagggtcaggcagaccctccatttttac
agagagaggaggggacgactgggtcccctgttgaagggaggaaaaggtcctgcccaggac

 2.05 PlyA -   5664   5659    6                              -3.74
 2.04 Term -   5945   5794  152  0  2   72   47    95 0.421   2.82
 2.03 Intr -   6345   6254   92  2  2   67   59   121 0.995   7.90
 2.02 Intr -   6513   6406  108  2  0   97   72     7 0.594   0.57
 2.01 Intr -   6768   6611  158  0  2   68   64   189 0.829  14.50

Predicted peptide sequence(s):


>CHAD_1|GENSCAN_predicted_peptide_1|359_aa
MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNN
PWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH

>CHAD_1|GENSCAN_predicted_peptide_2|169_aa
TPEQLRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRESQETEDGD
SGGPPGEDQFLPQELLLPIPFAAVSWRGGGTFLYGTPTMFVDILNQPDFSSYDISTMCGG
VIAGSPAPPELIRAIINKINMKDLVVSGDCGPGCGQARPGMTADGQTWG