GENSCAN 1.0	Date run: 15-Jan-104	Time: 13:30:55

Sequence BIRC5_1 : 12828 bp : 49.69% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1250   1360  111  1  0   91   80    62 0.636   5.93
gagccacgcggcgggaggactacaactcccggcacaccccgcgccgccccgcctctactc
ccagaaggccgcggggggtggaccgcctaagagggcgtgcgctcccgacatgccccgcgg
cgcgccattaaccgccagatttgaatcgcgggacccgttggcagaggtggcggcggcggc
ATGGGTGCCCCGACGTTGCCCCCTGCCTGGCAGCCCTTTCTCAAGGACCACCGCATCTCT
ACATTCAAGAACTGGCCCTTCTTGGAGGGCTGCGCCTGCACCCCGGAGCGG
gtgagactgcccggcctcctggggtcccccacgcccgccttgccctgtccctagcgaggc
cactgtgactgggcctcgggggtacaagccgccctcccctccccgtcctgtccccagcga
ggccactgtggctgggccccttgggtccaggccggcctcccctccctgctttgtccccat

 1.02 Intr +   1613   1722  110  1  2  115  103   107 0.872  13.98
gcctcgggggtacaagccgccctcccctccccgtcctgtccccagcgaggccactgtggc
tgggccccttgggtccaggccggcctcccctccctgctttgtccccatcgaggcctttgt
ggctgggcctcggggttccgggctgccacgtccactcacgagctgtgctgtcccttgcag
ATGGCCGAGGCTGGCTTCATCCACTGCCCCACTGAGAACGAGCCAGACTTGGCCCAGTGT
TTCTTCTGCTTCAAGGAGCTGGAAGGCTGGGAGCCAGATGACGACCCCAT
gtaagtcttctctggccagcctcgatgggctttgttttgaactgagttgtcaaaagattt
gagttgcaaagacacttagtatgggagggttgctttccaccctcattgcttcttaaacag
ctgttgtgaacggatacctctctatatgctggtgccttggtgatgcttacaacctaatta

 1.03 Intr +   3597   3714  118  0  1   89   34    57 0.978   0.87
ggtgccatatgggaatgtggcttgggcaaagcactgatgccatcaacttcagacttgacg
tcttactcctgaggcagagcagggtgtgcctgtggagggcgtggggaggtggcccgtggg
gagtggactgccgctttaatcccttcagctgcctttccgctgttgttttgatttttctag
AGAGGAACATAAAAAGCATTCGTCCGGTTGCGCTTTCCTTTCTGTCAAGAAGCAGTTTGA
AGAATTAACCCTTGGTGAATTTTTGAAACTGGACAGAGAAAGAGCCAAGAACAAAATT
gtatgtattgggaataagaactgctcaaaccctgttcaatgtctttagcactaaactacc
tagtccctcaaagggactctgtgttttcctcaggaagcattttttttttttttctgagat
agagtttcactcttgttgcccaggctggagtgcaatggtgcaatcttggctcactgcaac

 1.04 Term +  10398  10487   90  2  0  102   54   180 0.734  13.72
gggagttgagctgaatcaggatgtttgtcccaggtagctgggaatctgcctagcccagtg
cccagtttatttaggtgctctctcagtgttccctgattgttttttcctttgtcatcttat
ctacaggatgtgactgggaagctctggtttcagtgtcatgtgtctattctttatttccag
GCAAAGGAAACCAACAATAAGAAGAAAGAATTTGAGGAAACTGCGGAGAAAGTGCGCCGT
GCCATCGAGCAGCTGGCTGCCATGGATTGA
ggcctctggccggagctgcctggtcccagagtggctgcaccacttccagggtttattccc
tggtgccaccagccttcctgtgggccccttagcaatgtcttaggaaaggagatcaacatt
ttcaaattagatgtttcaactgtgctcttgttttgtcttgaaagtggcaccagaggtgct

Predicted peptide sequence(s):


>BIRC5_1|GENSCAN_predicted_peptide_1|142_aa
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD