GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:03:42

Sequence BCL6B_1 : 7381 bp : 55.72% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1522   1560   39  0  0   79   42    76 0.428   2.38
gattggggactagataggagtcgcagaattccgtagttcggggaagggagcctcggctgg
gatttggaggtgtgtggacggcaggccgtgagatctcgaggcagggttggacacctgaga
cacaggcgcgcagaggggagtggcggtgctggaggggcactgggggtcgaacccagggcg
ATGGGCGCGGGATTCCCCACGCTCGCCAACGACGCCGCG
gtgtggaaccttcaactggctccaagcgctgtgggatctggaagaggcaagggagcgagg
gtgtcgtagagggcagaatgaacaagaagaattaggagggaggctgcgtgtgccggggct
aggggctggaagtcctggctctagttgcacctcggaaggaaaaggcaaacagaggaggga

 1.02 Intr +   1791   1981  191  2  2   51   52   279 0.623  19.50
gggagcgagggtgtcgtagagggcagaatgaacaagaagaattaggagggaggctgcgtg
tgccggggctaggggctggaagtcctggctctagttgcacctcggaaggaaaaggcaaac
agaggagggaaggcgtcttaggactgcctggatccagagcactttccacggcctctacag
GCCTGTGTCGCTATGGGTTCCCCCGCCGCCCCGGAGGGAGCGCTGGGCTACGTCCGCGAG
TTCACTCGCCACTCCTCCGACGTGCTGGGCAACCTCAACGAGCTGCGCCTGCGCGGGATC
CTCACTGACGTCACGCTGCTGGTTGGCGGGCAACCCCTCAGAGCACACAAGGCAGTTCTC
ATCGCCTGCAG
gttcgaggggtggggcctggggcggggccaaatgggaaaggggtgggaccacagggccgt
tgagagggaatccgaagccaagtctttcagaagcaggaggcggagcgtcccagaattggg
ggcggggtgatagtgaggaggcgggactttttcagggggcggggcttcctgaagctgcgc

 1.03 Intr +   2214   2435  222  0  0   72   94   145 0.999  11.27
agggccgttgagagggaatccgaagccaagtctttcagaagcaggaggcggagcgtccca
gaattgggggcggggtgatagtgaggaggcgggactttttcagggggcggggcttcctga
agctgcgcatgtctcccttggttccccagcccccaaaggacttatctgctctctctctag
TGGCTTCTTCTATTCAATTTTCCGGGGCCGTGCGGGAGTCGGGGTGGACGTGCTCTCTCT
GCCCGGGGGTCCCGAAGCGAGAGGCTTCGCCCCTCTATTGGACTTCATGTACACTTCGCG
CCTGCGCCTCTCTCCAGCCACTGCACCAGCAGTCCTAGCGGCCGCCACCTATTTGCAGAT
GGAGCACGTGGTCCAGGCATGCCACCGCTTCATCCAGGCCAG
gtgagggaccctggctcggcgttctctgtgggtgaggtgttaagggcaaaggcagagttt
aggaaatggcactaacgttcatcacactttccccagctatgaacctctgggcatctccct
gcgccccctggaagcagaacccccaacacccccaacggcccctccaccaggtagtcccag

 1.04 Intr +   2532   2894  363  0  0   57   92   304 0.992  22.56
cactgcaccagcagtcctagcggccgccacctatttgcagatggagcacgtggtccaggc
atgccaccgcttcatccaggccaggtgagggaccctggctcggcgttctctgtgggtgag
gtgttaagggcaaaggcagagtttaggaaatggcactaacgttcatcacactttccccag
CTATGAACCTCTGGGCATCTCCCTGCGCCCCCTGGAAGCAGAACCCCCAACACCCCCAAC
GGCCCCTCCACCAGGTAGTCCCAGGCGCTCCGAAGGACACCCAGACCCACCTACTGAATC
TCGAAGCTGCAGTCAAGGCCCCCCCAGTCCAGCCAGCCCTGACCCCAAGGCCTGCAACTG
GAAAAAGTACAAGTACATCGTGCTAAACTCTCAGGCCTCCCAAGCAGGGAGCCTGGTCGG
GGAGAGAAGTTCTGGTCAACCTTGCCCCCAAGCCAGGCTCCCCAGTGGAGACGAGGCCTC
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTGAAGAAGGACCCATTCCTGGTCCCCAGAG
CAG
gtacagagtctagaacctcaagaatttgtcagagctggcctcagctagaagacagagtca
ttgggccttgatggtcaggaggaagggagataggtggtgggtttcagagacactagctca
ccttaaggagctggccagagaccaggtttattcagcagggtggcacttgggcagtacaat

 1.05 Intr +   3207   3331  125  0  2   91   94    36 0.998   5.23
ggccagagaccaggtttattcagcagggtggcacttgggcagtacaatggatgtggctca
ttggtcaacaatattggctcaccctgagagggcaggcctttggctccaaatttcccagga
gagaacccccacccctcaaccgtacaatctcttttaaccctttccttgccatctgcctag
GCTCTCTCCAACTGCTGCCACTGTGCAGTTCAAATGTGGGGCTCCAGCCAGTACCCCCTA
CCTCCTCACATCCCAGGCTCAAGACACCTCTGGATCACCCTCTGAACGGGCTCGTCCACT
ACCGG
gtaagagcccctctttcttggcttttctcccgtgactgctccaggcaagtttgtgccaaa
aactctcccagaaaggcctattccaatggttcctaaactttattacaaattagaatcacc
taggaagcttttaaactcccactgcccaggtcacactccatagattaaaatatctggaca

 1.06 Intr +   4588   4752  165  2  0   89   91   196 0.999  20.45
gtcagatctggctcatcttactatcttcttacttggccttgagcaagtcaaaccagcccc
agaagtcttaacaataaattgggaaacagaaagcctgctactgtgtggtttgaggattca
gtagtacctagatagccctcattaataactatggttgccgtcacccattccccttcccag
GAAGTGAATTTTTCAGCTGCCAGAACTGTGAGGCTGTGGCAGGGTGCTCATCGGGGCTGG
ACTCCTTGGTTCCTGGGGACGAAGACAAACCCTATAAGTGTCAGCTGTGCCGGTCTTCGT
TCCGCTACAAGGGCAACCTTGCCAGTCATCGTACAGTGCACACAG
gtaggggaagagagggccctggccttcaagcccacagctgtcctagggcaaagtccctga
tctcccatgttctctgcctccaggggaaaagccttaccactgctcaatctgcggagcccg
ttttaaccggccagcaaacctgaaaacgcacagccgcatccattcgggagagaagccgta

 1.07 Intr +   4836   4966  131  1  2  105   96   147 0.963  18.12
gttcctggggacgaagacaaaccctataagtgtcagctgtgccggtcttcgttccgctac
aagggcaaccttgccagtcatcgtacagtgcacacaggtaggggaagagagggccctggc
cttcaagcccacagctgtcctagggcaaagtccctgatctcccatgttctctgcctccag
GGGAAAAGCCTTACCACTGCTCAATCTGCGGAGCCCGTTTTAACCGGCCAGCAAACCTGA
AAACGCACAGCCGCATCCATTCGGGAGAGAAGCCGTATAAGTGTGAGACGTGCGGCTCGC
GCTTTGTACAG
gtacggagccagcctccaagtggcttccaaggcaaacctgcaagaggtggggtgggccaa
tagggagggttctgttcctcccagaggcaggacttgaagtctcctccctcccaggtggca
catctgcgggcgcacgtgctgatccacaccggggagaagccctacccttgccctacctgc

 1.08 Intr +   5081   5218  138  1  0   81   44   240 0.954  20.07
cacagccgcatccattcgggagagaagccgtataagtgtgagacgtgcggctcgcgcttt
gtacaggtacggagccagcctccaagtggcttccaaggcaaacctgcaagaggtggggtg
ggccaatagggagggttctgttcctcccagaggcaggacttgaagtctcctccctcccag
GTGGCACATCTGCGGGCGCACGTGCTGATCCACACCGGGGAGAAGCCCTACCCTTGCCCT
ACCTGCGGAACCCGCTTCCGCCACCTGCAGACCCTCAAGAGCCACGTTCGCATCCACACC
GGAGAGAAGCCTTACCAC
gtgggtacccaacctggcctgcccactgccttagaattacctctcctttgcctaggggtg
ggctctgagaggtgcgggcctggctgtccctagatctcttagaaatgagcggtggccgga
agagtccaagcaaataaggggtggaggctgggagtcaggatgggcaggtatagaagtgat

 1.09 Term +   5634   5750  117  2  0   85   37   146 0.936   8.04
tgctaaataaggcggggcctatcccctcagccacccctgaggatttgggaggatgtgaga
gtcaaagagctgatcttccgctggatagttcccacctgggagagctggacggccgcccgg
ctcaacacctaaaaggtgattgtggatggggcagggcctgacttggctgtcctcccacag
TGCGACCCCTGTGGCCTGCATTTCCGGCACAAGAGTCAACTGCGGCTGCATCTGCGCCAG
AAACACGGAGCTGCTACCAACACCAAAGTGCACTACCACATTCTCGGGGGGCCCTAG
ctgagcgcaggcccaggccccacttgcttcctgcgggtgggaaagctgcaggcccaggcc
ttgcttccctatcaggcttgggcataggggtgtgccaggccactttggtatcagaaattg
ccaccctcttaatttctcactggggagagcaggggtggcagatcctggctagatctgcct

Predicted peptide sequence(s):


>BCL6B_1|GENSCAN_predicted_peptide_1|496_aa
MGAGFPTLANDAAACVAMGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLL
VGGQPLRAHKAVLIACSGFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRL
SPATAPAVLAAATYLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRR
SEGHPDPPTESRSCSQGPPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCP
QARLPSGDEASSSSSSSSSSSEEGPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQD
TSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNL
ASHRTVHTGEKPYHCSICGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHV
LIHTGEKPYPCPTCGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKH
GAATNTKVHYHILGGP