GENSCAN 1.0	Date run: 15-Jan-104	Time: 15:44:42

Sequence AXIN2_1 : 31583 bp : 50.10% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1290   2104  815  2  2   84  110   606 0.828  56.59
ctggttttgattagatcaatacccttttctctctccccacctccccccttccttttcttt
ccagagaggaggttcagatgagcccctgctgacttgagagagacagagagaccacgccga
ttgctgagaggaactggaagaagaaaaattcccagactcagtgggaagagctccctcacc
ATGAGTAGCGCTATGTTGGTGACTTGCCTCCCGGACCCCAGCAGCAGCTTCCGTGAGGAT
GCCCCGCGGCCCCCAGTGCCAGGGGAAGAAGGGGAGACCCCACCGTGTCAGCCAGGGGTG
GGCAAGGGCCAGGTCACCAAACCCATGCCTGTCTCTTCCAACACCAGGCGGAACGAAGAT
GGGTTGGGGGAGCCGGAGGGGCGGGCATCTCCGGATTCCCCTCTGACCCGGTGGACCAAG
TCCTTACACTCCTTATTGGGCGATCAAGACGGTGCTTACCTGTTCCGAACTTTCCTGGAG
AGGGAGAAATGCGTGGATACCTTAGACTTCTGGTTTGCCTGCAATGGATTCAGGCAGATG
AACCTGAAGGATACCAAAACTTTACGAGTAGCCAAAGCGATCTACAAAAGGTACATTGAG
AACAACAGCATTGTCTCCAAGCAGCTGAAGCCTGCCACCAAGACCTACATAAGAGATGGC
ATCAAGAAGCAGCAGATTGATTCCATCATGTTTGACCAGGCGCAGACCGAGATCCAGTCG
GTGATGGAGGAAAATGCCTACCAGATGTTTTTGACTTCTGATATATACCTCGAATATGTG
AGGAGTGGGGGAGAAAACACAGCTTACATGAGTAATGGGGGACTCGGGAGCCTAAAGGTC
GTGTGTGGCTATCTCCCCACCTTGAATGAAGAAGAGGAGTGGACTTGTGCCGACTTCAAG
TGCAAACTTTCGCCAACCGTGGTTGGCTTGTCCAGCAAAACTCTGAGGGCCACGGCGAGT
GTGAGGTCCACGGAAACTGTTGACAGTGGATACAG
gtaagactttgacgggggcgggtgggctgatgctgtggactttgcagatgttttaagtat
ggtggatgggtggatgggtgtgctgcagagactgacaggtctgttgagttaggactgctg
gccatgaaccctttttgatcttgctttttgttgttgaaacagggggaaagcgatgcacat

 1.02 Intr +  10250  10386  137  2  2  107   20   204 0.864  15.71
ggctcaggaggcctcccttttgtggcccctgctttctgcccaggtgagcaactggacctg
ggcagcaggttggcgttgagcagattgtgggatagtgtgctgggttgtcctggggtcacc
tgattacctgggtttctggtgagggtcagtgactgaaccacttttgtactttgcccatag
GTCCTTCAAGAGGAGCGATCCTGTTAATCCTTATCACATAGGTTCTGGCTATGTCTTTGC
ACCAGCCACCAGCGCCAACGACAGTGAGATATCCAGTGATGCGCTGACGGATGATTCCAT
GTCCATGACGGACAGCA
gtgtgtgagtatcctggccacccttccgtgggcttgcttgggagtggatgccacctgagc
acttagccagaatcgtctgtcatcctcagctggctttgcagaccgcacctgtgcatgtat
ggacatcagtttggtgggaggggagtatgacaagggtatggtgctgattaaggaggatga

 1.03 Intr +  10476  10584  109  1  1   60   65   120 0.690   6.24
ggctatgtctttgcaccagccaccagcgccaacgacagtgagatatccagtgatgcgctg
acggatgattccatgtccatgacggacagcagtgtgtgagtatcctggccacccttccgt
gggcttgcttgggagtggatgccacctgagcacttagccagaatcgtctgtcatcctcag
CTGGCTTTGCAGACCGCACCTGTGCATGTATGGACATCAGTTTGGTGGGAGGGGAGTATG
ACAAGGGTATGGTGCTGATTAAGGAGGATGACATGGTCATCTGGGTAGG
gtaaagcttagagctttgaaagttgggaggatattgtaacagaagaaaaactaaaggaca
gtagaagattaggatgaatgaatatttatagattccttgagtttaaaaaaccttcttctg
gttgtcatcatctggttgtccctgtgggaacagttgcttggctggtccagaaacccaggt

 1.04 Intr +  18353  18455  103  2  1   92  117    45 0.987   7.98
tttgaccttgggtgggtccttccctgtgggagcaccgatggtatctggagacatgtgaca
ctcctatggaagcatgtggccctgtcggcgggatctcaagatggcatatgacagtagccc
atgtgatgtgctgaaaacatcctcgtaagcctgtggattctgtcttttcctttcccttag
AGATGGAATTCCTCCTTATCGTGTGGGCAGTAAGAAACAGCTCCAGAGAGAAATGCATCG
CAGTGTGAAGGCCAATGGCCAAGTGTCTCTACCTCATTTCCCG
gtgagtacagtctggagtgaggagacagctgttttctgccatgttgagtcctaaagaaaa
gaaatgggtggtggaatggggagaggtatagggaaggtagaaaagagcagtacctaaggt
cccctagggcaaagggagagaaaagaactggacaataggcattacatggttttttgggtt

 1.05 Intr +  21567  21707  141  2  0   88   80   177 0.995  17.45
tccatgaggccatggcgctagcgcataaaagtcccgagcagcccaggccgccttgccatc
cactctacacccgaacatgggtttgcggtgcacagcgcctggtgcgggaagctccggcca
agccaccgcccacctagcctgctgaacgtgcctcctccctttcctttccacgtcctgtag
AGAACCCACCGCCTGCCCAAGGAGATGACCCCCGTGGAACCCGCCACCTTTGCAGCTGAG
CTGATCTCGAGGCTGGAAAAGCTGAAGCTGGAGTTGGAGAGCCGCCACAGCCTGGAGGAG
CGCCTGCAGCAGATCCGAGAG
gtaatgcggcctaggccttcttcctgcttccgtccacggcgtgagcgctcgtatgtgtat
gcgcatgtgcatggggtgcgttagggtgtgcgcatgtgcgtgggttgcatgcgcatgcgc
gtgggctgcgtgtgggtgtgtgcctgggcgtgggctgtgtgcgcatgtgcatgggttgcg

 1.06 Intr +  22075  22586  512  0  2  142  106   499 0.999  48.87
gtgcatatgcgtgtggatatgtgcttgtgtaggcgggcctgtgcgtgtgcgcatgggcgt
ggctgtgggcgtgcacacgggtgtgcgtgctcctgcgtagggagccgaatgttgcaaccc
cagggcctctggcccttctgcttcctgggtcacttctccttctgacgtcttccctttcag
GATGAAGAGAGAGAGGGCTCCGAGCTCACACTCAATTCGCGGGAGGGGGCGCCCACGCAG
CACCCCCTCTCCCTACTGCCCTCCGGCAGCTACGAGGAAGACCCGCAGACGATACTGGAC
GATCACCTGTCCAGGGTCCTCAAGACCCCTGGCTGCCAGTCTCCAGGCGTAGGCCGCTAT
AGCCCCCGCTCCCGCTCCCCGGACCACCACCACCACCACCATTCGCAGTACCACTCCCTG
CTCCCGCCCGGTGGCAAGCTGCCTCCCGCGGCCGCCTCGCCGGGCGCCTGCCCCCTCCTC
GGGGGCAAAGGCTTTGTGACCAAGCAGACGACGAAGCATGTCCACCACCACTACATCCAC
CACCATGCCGTCCCCAAGACCAAGGAGGAGATCGAGGCGGAGGCCACGCAGCGGGTGCAC
TGCTTCTGCCCTGGGGGCAGCGAGTATTACTGCTACTCGAAATGCAAAAGCCACTCCAAG
GCTCCGGAAACCATGCCCAGCGAGCAGTTTGG
gtaagtgccgggcggaccgcagtgtcccgtgtggggcttgtctcccagccaggtccatgg
gcaggtgtgaggtgggagccgcattacaggcatttagtttctaagagggcggcagagtgc
acggccgggtgagggtgcggggagcaggtgcatgggtctttcgtgtcaccagccccccga

 1.07 Intr +  22847  23041  195  2  0   91   65   118 0.936   8.33
gcattacaggcatttagtttctaagagggcggcagagtgcacggccgggtgagggtgcgg
ggagcaggtgcatgggtctttcgtgtcaccagccccccgacttgctgaattgtctgattc
taggagtcccggagatttaaccgggtctctgggttgggtgtggttcttggttccccacag
CGGCAGCAGAGGCAGTACCTTGCCCAAACGCAATGGGAAAGGCACGGAGCCGGGCCTGGC
CCTGCCCGCCAGGGAAGGAGGGGCCCCCGGCGGAGCTGGGGCCCTGCAGCTTCCCCGGGA
GGAAGGAGACAGGTCGCAGGATGTCTGGCAGTGGATGCTGGAGAGTGAGCGGCAGAGCAA
GCCCAAGCCCCATAG
gtaaacaccgcttgccgccgccgcggccgcgagggtcatgggcactcagtacggaggtat
tgtgggaatggctgtttttgcagtccgcggaatacaaatgtgactatttgctcctgccat
cttaatattaaacgttggactgagcagaccacaaaaatgtcatgttttggcactgacccc

 1.08 Intr +  23357  23590  234  2  0   93  101    85 0.975   7.10
tggactgagcagaccacaaaaatgtcatgttttggcactgacccctgttcatgttatggt
agttttttttttaactctctctctgagcagaatagacaagtttctattgaagtcacattt
tccagttcttctaacccagtttctttccttctgttttctctctgctcattccttgtttag
TGCCCAAAGCACAAAAAAGGCCTACCCCTTGGAGTCTGCCCGCTCGTCTCCAGGCGAACG
AGCCAGCCGGCACCATCTGTGGGGGGGCAACAGCGGGCACCCCCGCACCACCCCCCGTGC
CCACCTGTTCACCCAGGACCCTGCGATGCCTCCCCTGACCCCACCCAACACGCTGGCTCA
GCTGGAGGAGGCCTGTCGCAGGCTAGCTGAGGTGTCGAAGCCCCCAAAGCAGCG
gtgagtggaagtgaagggtcctaggttgaggcagggattgggtttgggtggagacctggt
ctgtggctaatggggagggcctctctttctgcctgggtctcaaaccctcccatgagaaga
agaattacttatggatgagtaagctgctgctttccagcttctagaaattgttcccttcag

 1.09 Intr +  24189  24284   96  0  0   98   70    46 0.879   2.92
caagacgtcttcctggcctcttcagccactgttaacccagggtcttggttgggtctccgt
aaggatggaagtcgggttcgtgtctcttcaggaggccaaatagtaattttctgtctgctt
ttcaattgctctggggacaacagtgtacctctaaatccctcgccctggctgtgtcctcag
GTGCTGTGTGGCCAGTCAGCAGAGGGACAGGAATCATTCGGCCACTGTTCAGACGGGAGC
CACACCCTTCTCCAATCCAAGCCTGGCTCCAGAAGA
gtgagtgtctttacctgacattactgagatctgccgagtgctttatgtttcagaatattc
gctatctggagtttcattttcatgaaactttttttggtttttaaaatcactttgatttta
gcgctagtgatgaggaacagtaaacgtagatgttgccatccatgtcctgccgacaaatgc

 1.10 Intr +  25831  25998  168  1  0   75   82   121 0.969   9.26
ccccagagctgcctgactctgggatgtggggctctgccccagcccccactttgggtttac
aattgcagccctagtgtttggataccctgtcacttatgcacatgtgcgcacgtgtgtgtt
tgctttagatgtgtgtctgctttaaaatgctaaacttgttccattccatcttattttcag
TCACAAAGAGCCAAAGAAACTGGCAGGTGTCCACGCGCTCCAGGCCAGTGAGTTGGTTGT
CACTTACTTTTTCTGTGGGGAAGAAATTCCATACCGGAGGATGCTGAAGGCTCAGAGCTT
GACCCTGGGCCACTTTAAAGAGCAGCTCAGCAAAAAGGGAAATTATAG
gtaagagtcctgtggcttttttctgctctcagtttgtttgctcagaaccaagagccagag
cctggagcagctcccctggctgagcagacctaggtggggcagggtgggagggggctcagc
aggcgctgggggaggctcccttctcatttcttctctcccctcaccgctagcagcaataac

 1.11 Term +  29808  29934  127  0  1   58   52   165 0.971   7.66
gcttcttgtggtgtggccagtcccagctgccgtcttaaagcagatgtgcgcaacagtgta
caggcacacctgccatagcaaattcctaggatacctcagtcctccatgttggtatgcttt
tcttttcaacaatgtggaaaatgcagtttaccaagaagcttttttggttttccttttaag
GTATTACTTCAAAAAAGCAAGCGATGAGTTTGCCTGTGGAGCGGTGTTTGAGGAGATCTG
GGAGGATGAGACGGTGCTCCCGATGTATGAAGGCCGGATTCTGGGCAAAGTGGAGCGGAT
CGATTGA
gccctggggtctggctttggtgaactgttggagcccgaagctcttgtgaactgtcttggc
tgtgagcaactgcgacaaaacattttgaaggaaaattaaaccaatgaagaagacaaagtc
taaggaagaatcggccagtgggccttcgggagggcggggggaggttgattttcatgattc

Predicted peptide sequence(s):


>AXIN2_1|GENSCAN_predicted_peptide_1|878_aa
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSTGFADRTCACMDISLVGGEYDKGMVLIKEDDMVIWVGDGIPPY
RVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPKEMTPVEPATFAAELISRLEKLKLEL
ESRHSLEERLQQIREDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSR
VLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLLGGKGF
VTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSKAPETM
PSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLE
SERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAM
PPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPE
DHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYF
KKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID