GENSCAN 1.0	Date run: 15-Jan-104	Time: 14:03:30

Sequence ALOX12_1 : 17048 bp : 49.11% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    844    930   87  2  0   84   27    78 0.465   1.24
gaggacacatgggccgcgccgggtctagccgcgggacatccccagaccccagcacggcct
cccaggccgaccttccagaagccggcccactgccttccccgggtcccagcccagaaaagc
ggagaccttcccctccgtttggaagatggactcatcccctacttcctcctggctccccag
AAGACCTGGAGACCTCGGGAAGTGTTCTCATCTATGTTCGCTCCAACCCGGGGGCTCAGG
CCCACCTCGATCCCGCCTTCCCGGGAG
gtccaggaaggtcccgccgcacccaccccgttggcctcaccctggctcgggcccctttat
catcctgcagctacgctccgaccaggaggcacagccagtccccacagccggctctaccgc
tctgctcgcaggtttgggctagtctggggcggggacttgggagcgcctaaaacttgcgag

 1.02 Intr +   1001   1368  368  0  2   91   60   295 0.730  21.87
cctacttcctcctggctccccagaagacctggagacctcgggaagtgttctcatctatgt
tcgctccaacccgggggctcaggcccacctcgatcccgccttcccgggaggtccaggaag
gtcccgccgcacccaccccgttggcctcaccctggctcgggcccctttatcatcctgcag
CTACGCTCCGACCAGGAGGCACAGCCAGTCCCCACAGCCGGCTCTACCGCTCTGCTCGCA
GGTTTGGGCTAGTCTGGGGCGGGGACTTGGGAGCGCCTAAAACTTGCGAGGAGGGCGGGG
CCGCAGACCGGTCCTTTAAAGGTTGGAAGTGGCCCCGAGGCGCCGGCAGCCCTGGGCGGT
CCCGGGAATCGCACAGGACCCGGCTCCCCTCGCCTAAGCTGCTGGGGGGCGCCATGGGCC
GCTACCGCATCCGCGTGGCCACCGGGGCCTGGCTCTTCTCCGGGTCGTACAACCGCGTGC
AGCTTTGGCTGGTCGGGACGCGCGGGGAGGCGGAGCTGGAGCTGCAGCTGCGGCCCGCGC
GGGGCGAG
gtcagcgcggggagcgaggggagctagggcagcggggaccccgggcccaggcccgggccg
agctgggctcgcggcgggagggcgggaggctgggggcgaggtgacagcgcgacctcgcgg
actgggacttccacgaagctgggacgaggtgggcaagattagggacagggtccgcagctg

 1.03 Intr +   1942   2143  202  0  1   48  105   409 0.900  37.46
tcctccacccgactccgggcgtctgagacccaaagagcaggttgtgcgggggcgggaacg
aggcgatgctgtctttggaggccctgagaaactgaggttgcacaggagcgcggctctgtc
ctcgaaacggcctcagtcgggtccctcctactaagtctggcctgggtccggcctgcacag
GAGGAGGAGTTTGATCATGACGTTGCAGAGGACTTGGGGCTCCTGCAGTTCGTGAGGCTG
CGCAAGCACCACTGGCTGGTGGACGACGCGTGGTTCTGCGACCGCATCACGGTGCAGGGC
CCTGGAGCCTGCGCGGAGGTGGCCTTCCCGTGCTACCGCTGGGTGCAGGGCGAGGACATC
CTGAGCCTGCCCGAGGGCACCG
gtgagcaggcggcgtcggggaaggaggcacaaggtctcgggaactgctgcggggctagga
gggcagagttaaggacggtcggagcagacttagaggatgtatgggcccagggcaggtgaa
atgtagggatcccagggtgctggacagaaaacgggaaggagttatgaattcccaaagttt

 1.04 Intr +   3625   3706   82  2  1   64   20   104 0.796  -0.10
aaagttggcaaagatgggataaacgtgtctggtggataatcaaatgaggcaaagccagag
ataaaagcaacagtgcatggctgaaaacatggaatacggctaaccacagggagatgagga
caagaggcgggcataggaccagacagagccgtgaggccaattgtcttgatgtctccccag
CCCGCCTGCCAGGAGACAATGCTTTGGACATGTTCCAGAAGCATCGAGAGAAGGAACTGA
AAGACAGACAGCAGATCTACTG
gtgaccacccaccccttaaactaaccccgccaccactgtcccaccccttccctgcccctg
cccctgcccctggccccatcactgaccatgacatccttcctgaagctttgtccccaactc
ctagctgggccacctggaaggaagggttacccctgaccatcgctgcagaccgtaaggatg

 1.05 Intr +   3831   3953  123  0  0   45   76   131 0.878   7.30
gacatgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactggtga
ccacccaccccttaaactaaccccgccaccactgtcccaccccttccctgcccctgcccc
tgcccctggccccatcactgaccatgacatccttcctgaagctttgtccccaactcctag
CTGGGCCACCTGGAAGGAAGGGTTACCCCTGACCATCGCTGCAGACCGTAAGGATGATCT
ACCTCCAAATATGAGATTCCATGAGGAGAAGAGGCTGGACTTTGAATGGACACTGAAGGC
AGG
gtgagaaaaaggctagacctcggagtgaaataagggctgggagggccaagaatgatgata
gacggtgagggactgagggatcagctgatgagttaagcctcaatacctgtcctagggctc
tggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgcctagaagact

 1.06 Intr +   4069   4172  104  1  2   60   65   133 0.986   8.02
ctacctccaaatatgagattccatgaggagaagaggctggactttgaatggacactgaag
gcagggtgagaaaaaggctagacctcggagtgaaataagggctgggagggccaagaatga
tgatagacggtgagggactgagggatcagctgatgagttaagcctcaatacctgtcctag
GGCTCTGGAGATGGCCCTCAAACGTGTTTACACCCTCCTGAGCTCCTGGAACTGCCTAGA
AGACTTTGATCAGATCTTCTGGGGCCAGAAGAGTGCCCTGGCTG
gtcagtggttccccgaggtctccataatcccttaatggcccctctggatgactcatcaca
ctccacagtcccccgtaactctttgcaagaagagaccttatcatatctggtcaactcaga
gaggccttgagaatgaaaacgcagaagctgggttcagggagggttatatacctgaacccc

 1.07 Intr +   4422   4582  161  1  2   20   82   152 0.985   7.51
cccccgtaactctttgcaagaagagaccttatcatatctggtcaactcagagaggccttg
agaatgaaaacgcagaagctgggttcagggagggttatatacctgaacccctggggtaga
ttttggagaagggatatgcaggctgtggtacatatatcctcctttcaccgcccaccaaag
AGAAGGTTCGCCAGTGCTGGCAGGATGATGAGTTGTTCAGCTACCAGTTCCTCAATGGTG
CCAACCCCATGCTGTTGAGACGCTCGACCTCTCTGCCCTCCAGGCTAGTGCTGCCCTCGG
GGATGGAAGAGCTTCAGGCTCAACTGGAGAAAGAACTTCAG
gtacctctccttcccctgcctggcactgttctctccttagtagtgtggtgagaacggaca
gagagaatccaaactgagtcagaggaaggctgcagtactgcattgccccttggtgcagtc
ctgtgctggaaaaatacagaaataaaatatgtaggggaagaaactatgaggagctcccag

 1.08 Intr +   5452   5595  144  0  0   80  110   248 0.999  26.68
agactgtttcttcactttaagatgagaggaactggaccaggggctctagttctcccaaca
gggctccggtactgatgcaggagaatggcaagaagctagactaaatctcttgccctttgc
cccggccccctgggggtagactttgaactctaaaaatggatacatccctcctgtccccag
AATGGTTCCCTGTTTGAAGCTGACTTCATCCTTCTGGATGGAATTCCAGCCAACGTGATC
CGAGGAGAGAAGCAATACCTGGCTGCCCCCCTCGTTATGCTGAAGATGGAGCCCAATGGG
AAGCTGCAGCCCATGGTCATCCAG
gtaagggccccagacctctcccacaacgttgcactctgttcacctcaacctctgctccca
gggacccaacccccagctcttggctcccaaaccccatcctcactcagtgagacttgtctt
catgtcactatttgcctgtaccctcgtctcccctgcctcatccaactagaattacttttt

 1.09 Intr +   6718   6927  210  0  0   69   75    95 0.457   5.41
tccacctgacatcagggcactccagctagcgagcggcaggctgggagggttcacagtcct
cctgctagactataacctcctagaaggcaataatcttacttagtcatctctgtttcccca
agaatgctgactataatgtcatatacggaatgggagttcaataatttctctttctcccag
ATTCAGCCTCCCAACCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCA
CTTGCCTGGCTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATC
CAGTATCACTTGCTGAACACTCACCTGGTGGCTGAGGTCATCGCTGTCGCCACCATGCGG
TGCCTCCCAGGACTGCACCCCATCTTCAAG
gtacttattaatctattaaatcacatatccctcagaccccagagagaggaacagccccat
atcaaaagatattgcagcagcaaaaactctttgtagcaatttgtgagtgaagaggagact
gtctcaatatcttgagatgttgattttaattaagtttattaagtttagtcacttaacatt

 1.10 Intr +  10373  10459   87  1  0   97  100   109 0.955  13.17
tccagggcccaactcacagggaagttggagagcacaagagtgagtgatcagaacagcagg
agatcagcctgtaaaggaaagcatcaagaggagaaggcgccatgctgggtgccaggccct
accaggaaggacccaagcatggcctccaccagtcacgccctccaatctcctcctctccag
TTCCTGATCCCCCATATCCGCTACACCATGGAAATCAACACCCGGGCCCGGACCCAACTC
ATCTCAGATGGAGGAATTTTTGATAAG
gtgaggagggtacggggcatgggactgcctcatccatctctccatgatctgccactttca
ggatccaagatcaactatgtgtgaatgtcctcactcttaacctatgaacctgtccctttt
atacccatgtcttttttttttttttttttttttttgagacagagtctagctctgtcgccc

 1.11 Intr +  10974  11143  170  2  2   84  109   121 0.952  12.54
actgtgttggccagactggtctcgaactcctgacctcatgatccacccacctcagcctcc
caaagtgctgtatacccatgtcttaatatctgaaaatcccacatttgccccactttatgg
aagatgtgttggttctccagccctgtttccccctctaagacctgtgatctcctgtcccag
GCAGTGAGCACAGGTGGAGGGGGCCATGTACAGTTGCTCCGTCGGGCGGCAGCTCAGCTG
ACCTACTGCTCCCTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCA
GGTGCTCTCTATGCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAG
gtgagtaaggaggagctgagaaatggtggggccggggggggggggggctctggcctgagg
ccagcatggggcaaaagcaagaaggtccagaaaggagaagcagagaactcaatcctgggg
agagatgaggaaaagtgaggacacagtgggtggctctgaaaatgaggagactgggatgag

 1.12 Intr +  11602  11723  122  1  2  113   94   131 0.943  16.34
tcctagaactaaggacccacatcttccatgagatgctagtgtgtttagagggctgaggat
gtcccaaaggcgaggtgtcttcccagatactgtggaagcattgggcagatgccacagaaa
gaggaatagaggtcagaggcgggggctttctgccctcaagtgccttttccccctgggcag
GTATGTGGAGGGGATCGTCCACCTCTTCTACCAAAGGGATGACATAGTGAAGGGGGACCC
TGAGCTGCAGGCCTGGTGTCGGGAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCG
AG
gtaagatccattctagagacagaagaagctcctgggagactctgccagggcgccttccca
gccctgcccttctggggacaggaccccagcctctcatcacgcctcccttcctccctccac
acgggaaagcatgtgtatcccattcccacctcctccgactcaggacaattctagagaccc

 1.13 Intr +  14863  14963  101  2  2   92   80    85 0.972   7.93
ctggcctatggtaactaagtgtaagtgactgagccaggacttaaacgcatgtctgatgca
aatacgtctaaataaaataaacaaattcatcaattctaaaatatgggcatcccaaaacaa
cagcctttgttcctctcctcttatgctgtagcttctaactgctattcctttcctgcccag
GTTTCCCTGTCTCCTTCCAGTCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCT
TCACGTGCACTGCCCAGCATGCCGCCATCAACCAGGGCCAG
gtatggacagctgaaagcccaggtccctgaaggcaaggtgacctgagggagagatgggag
ttcaaaccctaagtaccagggttctagggttacagtttcttcctccagctggactggtat
gcctgggtccctaatgctccatgcacaatgcggatgcccccacccaccaccaaggaagat

 1.14 Intr +  15072  15242  171  2  0   27   81   141 0.989   7.44
caactctgccatttcctcaccatgtgcgtcttcacgtgcactgcccagcatgccgccatc
aaccagggccaggtatggacagctgaaagcccaggtccctgaaggcaaggtgacctgagg
gagagatgggagttcaaaccctaagtaccagggttctagggttacagtttcttcctccag
CTGGACTGGTATGCCTGGGTCCCTAATGCTCCATGCACAATGCGGATGCCCCCACCCACC
ACCAAGGAAGATGTGACGATGGCCACAGTGATGGGGTCACTACCTGATGTCCGGCAGGCC
TGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGCCAGCCAGACATG
gtgagaggggactctcgggagagggaaatgacagttggaaaggaaacatcagagtgaggg
gctgggctctaggtgcgtttgtctttagaaactgactgatcctttgttctgtctcaggtg
cctctggggcaccacaaagaaaaatatttctcaggccccaagcccaaagctgtgctaaac

 1.15 Term +  15360  15539  180  2  0  118   52   168 0.999  13.81
gtccggcaggcctgtcttcaaatggccatctcatggcatctgagtcgccgccagccagac
atggtgagaggggactctcgggagagggaaatgacagttggaaaggaaacatcagagtga
ggggctgggctctaggtgcgtttgtctttagaaactgactgatcctttgttctgtctcag
GTGCCTCTGGGGCACCACAAAGAAAAATATTTCTCAGGCCCCAAGCCCAAAGCTGTGCTA
AACCAATTCCGAACAGATTTGGAAAAGCTGGAAAAGGAGATTACAGCCCGGAATGAGCAA
CTTGACTGGCCCTATGAATATCTGAAGCCCAGCTGCATAGAGAACAGTGTCACCATCTGA

gccctagagtgactctacctgcaagatttcacatcagctttaggactgacatttctatct
tgaatttcatgctttcctaaagtctctgctgctaaggctctatttcctcccccagttaaa
ccccctacattagtatcccactagcccaggggagcagtaaactttctctgcaaagactag

Predicted peptide sequence(s):


>ALOX12_1|GENSCAN_predicted_peptide_1|770_aa
XDLETSGSVLIYVRSNPGAQAHLDPAFPGATLRPGGTASPHSRLYRSARRFGLVWGGDLG
APKTCEEGGAADRSFKGWKWPRGAGSPGRSRESHRTRLPSPKLLGGAMGRYRIRVATGAW
LFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLLQFVRLRKHHWLVD
DAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNALDMFQKHREKELK
DRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTL
LSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVL
PSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQP
MVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVAEVIAV
ATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLRRAA
AQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDP
ELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAW
VPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEK
YFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI